KEGG   Auricoccus indicus: BVH56_02900Help
Entry
BVH56_02900       CDS       T04690                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbac  Auricoccus indicus
Pathway
sbac00010  Glycolysis / Gluconeogenesis
sbac00020  Citrate cycle (TCA cycle)
sbac00620  Pyruvate metabolism
sbac01100  Metabolic pathways
sbac01110  Biosynthesis of secondary metabolites
sbac01120  Microbial metabolism in diverse environments
sbac01130  Biosynthesis of antibiotics
sbac01200  Carbon metabolism
Module
sbac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVH56_02900
   00020 Citrate cycle (TCA cycle)
    BVH56_02900
   00620 Pyruvate metabolism
    BVH56_02900
Enzymes [BR:sbac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BVH56_02900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H Amelin ATP-synt_ab_Xtn RP-C_C HlyD_3 Presenilin
Motif
Other DBs
NCBI-ProteinID: AQL55942
UniProt: A0A1Q1G0Q0
LinkDB All DBs
Position
533560..534873
Genome map
AA seq 437 aa AA seqDB search
MSFEFKLPDIGEGIHEGEIVKWFVKDGDEIAEDDVLCEVQNDKAVVEIPSPVSGTVEKVH
VEEGTVAVVGDVIVSIDSPDAEGMTFKGSDEEDSSKKEEKKEAPKEEPKSENKEDNNSNA
SSNEDVDENRLVIAMPSVRKYAREQGVNIKAVSGSGKNGRILKEDIDAFNNGEQQSNASA
AEQTTGEAASTETAQKATEVPAGEMPETREKMSGMRKAIAKAMVNSKHTAPHVTIMDEID
VQKLWDHRKAYKSVAEEQGIKLTFLPYVVKALVSALKKYPALNTSIDDETMEIIQKHYYN
IGIAADTEKGLLVPVVKNADRKSMFAISDEINQLAAKARDGKLSSDEMKGATCTISNIGS
AGGQWFTPVINHPEVAILGIGRIAQKPIVVDGEIIAAPVLALSLSFDHRQIDGLTAQNAM
NHIKRLLNNPELLLMEG
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatttgaatttaaattacccgatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggttcgtcaaagatggcgatgaaattgctgaagatgatgtattatgtgaagtacaa
aacgacaaagcagttgttgaaattccatctccagtatcaggaactgttgaaaaagtgcat
gttgaagaaggtacagttgcggttgtcggtgatgtaattgtatcaatcgactctcctgat
gctgaaggcatgacgttcaaaggatctgatgaagaagatagctctaaaaaagaagaaaag
aaagaagcgccgaaagaagaacctaaatctgaaaacaaagaagacaataattctaatgca
tcatcaaatgaagatgttgatgaaaatcgattagtcattgcaatgccttctgtgcgtaaa
tacgctagagaacaaggtgtaaatattaaagcagtatctggttcaggtaaaaatggtcgt
atcttaaaagaagatatcgatgcatttaataacggtgaacagcaatcaaacgcttcagct
gctgagcaaacaactggagaagctgcatcaactgaaacagcacaaaaagcgactgaagta
ccagcaggtgaaatgcctgaaacacgtgagaagatgagtggtatgcgtaaagcgattgct
aaagcaatggttaactctaaacatactgcaccacacgtgacgattatggatgaaatcgat
gttcaaaaattatgggatcaccgtaaagcgtataaatcagttgctgaagaacaaggtatt
aaattaacattcttaccttacgttgtgaaagctttagtatcagcgcttaagaaataccca
gcattgaacacatcaatcgatgatgaaactatggaaatcattcaaaaacattattacaat
attggtattgcagcagacactgagaaaggtttattagttccagttgtgaaaaatgctgat
cgcaaatcaatgtttgcaatctcagatgaaatcaaccaacttgcagcgaaagctcgtgat
ggtaaattatcatctgacgaaatgaaaggtgcaacatgtacaatttctaacattggttca
gcaggtggacaatggtttacaccagttattaaccacccagaagttgcaatcttaggtatt
ggtcgtatcgctcagaaaccaattgttgttgatggtgaaattattgcagcaccagtactt
gcgttatcattaagttttgaccatagacaaattgatggattgactgcacaaaatgcaatg
aatcacattaagagattattaaataatccagaattattattaatggagggctaa

DBGET integrated database retrieval system