KEGG   Auricoccus indicus: BVH56_05155Help
Entry
BVH56_05155       CDS       T04690                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sbac  Auricoccus indicus
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbac01001]
    BVH56_05155
Enzymes [BR:sbac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BVH56_05155
Protein kinases [BR:sbac01001]
 Serine/threonine kinases: Other
  Bacterial family
   BVH56_05155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like Kdo APH Pkinase_fungal RIO1
Motif
Other DBs
NCBI-ProteinID: AQL56345
UniProt: A0A1Q1G1V2
LinkDB All DBs
Position
complement(993669..996041)
Genome map
AA seq 790 aa AA seqDB search
MIGEMIKDRYKIIQYIGRGGMGTVYKAYDTILNRDVAIKMIKVDPHAKEKTIKQFYKEVQ
TATNLYHDHLVNIYDVDENEEYCSIIMELVEGQTLKEFIQNNHPIDLEQVQKIMLQIMSA
IEVAHEANIIHRDIKPQNILIDEHNELKVTDFGISKATDSHTITETSNYLGSVEYAAPEQ
VKGKKTSEATDIYALGIILFELLSNQLPFSGETQVSIALQHIQDEIPEINQYREVSNRVN
NIILKATEKHPEDRFSSLKEMKNSIKYMLDDQPVSPYVLKFKENKTETIMLNSGIQKSTQ
HKESNEKLTAVPPVQKDQEDTLSKPTKKRYKWLFILLATLLVLVITSWFVFSMPREVEVP
DYKGLTLKQYEQLLTEEDLMIGEKYSEYNDDVKKDQIIKVTPNVGVEIEKNSSIDVLVSK
GEEPYKIEDFTGQKFDDVEQKLEKAKFKTIDSTEEYNYEFEEGHIISQSIEPDRSVIASK
SNIKFTVSKGPEMISILDYTNLSFDKAKSELEKEGFNVERKDEYSEDVEALDVMKQEPND
GELPKGSTVQITVSKGPKPQADKEYRESITLEHSEPSVEDESTEAPDDDQDGKDPLDEDS
DKDDEKTSEESTEEPTTNKSKRKQSESGQQQSSTADETAHNNKAKIKLVNNESTDVKVYI
SDKNHDIKEPVDEFTITEDTEYELKLVVEESMTAEYKIEINGEVWKSKKVHYDEIDEKDQ
ASDDSSNKSKETEDETEEDKENALSPDQSSKSNESNEPSTTEDKESKQNQSASIKESNRA
SKLSNMNSLL
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgattggtgagatgattaaagatcgatataaaattatacagtacattggtcgaggtgga
atggggactgtttacaaagcgtatgacacgatattaaatcgagatgttgccatcaagatg
atcaaagtagatcctcatgcgaaagaaaagacaattaagcaattttataaagaagttcaa
actgcaacgaatttataccatgatcatttagtgaatatatacgatgtagatgaaaatgaa
gagtattgttctattataatggaattagtcgaaggacaaactttgaaggaatttatacaa
aataaccatcctattgatttagagcaagtacagaaaataatgcttcaaattatgagcgcg
attgaagtggctcatgaggcaaacatcattcatcgtgatattaaacctcaaaatatttta
attgatgaacataacgaacttaaagtaactgattttggaattagtaaagcaactgacagc
cacacaattactgaaacaagtaattatttaggatcagtagaatatgcagcacctgagcaa
gtgaaaggtaagaaaacatcagaagctactgatatttatgcattaggaattattctcttc
gaactattaagcaatcaattaccattttctggtgaaacccaagtgagtattgctttgcaa
catattcaagatgaaattcccgaaattaatcaatatcgtgaagtatcaaatagagtgaac
aatattattttaaaagctactgaaaaacatcctgaggatcgcttttcatcgttaaaagaa
atgaaaaattcaattaagtatatgttagatgatcagccggtatcaccgtatgttctgaaa
tttaaagaaaataaaactgaaacaatcatgttaaattcaggcattcaaaaaagtacacag
cataaagaatctaatgaaaaattaactgctgttccacctgttcaaaaagatcaagaagat
acactatcgaaaccgactaaaaagcgatacaagtggttatttattttactcgcaacattg
ctagtgctagtgataacaagctggtttgtattttcaatgccaagggaagttgaagttcca
gattataaaggtttgacattaaaacagtatgaacagttattaacagaagaagatttaatg
attggcgaaaaatattcagagtataatgatgatgtaaaaaaagatcaaattattaaggtg
acaccaaatgtcggtgttgaaatcgagaaaaattcatcaattgatgtcctagtgagtaaa
ggtgaagaaccatataaaattgaggattttactggccaaaaatttgatgatgttgaacag
aaattagaaaaagcaaaatttaaaacaattgattcaacggaagaatataattatgaattc
gaagaaggtcatattatttcgcaatctattgaaccagatagaagtgttattgcatctaaa
tcaaatattaagttcaccgtttcaaaagggccagaaatgatctcgatattagattatacg
aacttatcattcgataaagcaaaatcagaacttgaaaaagaaggatttaatgtggaacgg
aaagatgagtattcagaagatgtcgaagctttagatgtgatgaagcaagaaccaaatgac
ggagaacttccgaaaggttctacagttcaaattactgtgagtaaagggccgaaaccacaa
gctgataaagaatatcgtgaatccattacgttagagcatagcgaaccaagtgttgaggat
gaatcaactgaagcacctgatgatgatcaagacggtaaagatccgttagatgaagacagt
gacaaagatgatgagaagacatcagaagaatcaacagaagagccgactactaataaatca
aaacgtaaacaatcagagtctggtcaacaacaaagtagtacagctgatgaaacagctcac
aataataaagccaaaattaaattagtaaataatgaatcaacagatgtaaaagtatatatt
agtgataaaaatcatgatattaaagaacctgttgatgaatttacaattacagaagataca
gaatatgaactgaaattagttgttgaagaatctatgacagcagaatataaaattgaaata
aatggtgaagtatggaaaagtaagaaagtacattatgatgaaatcgatgaaaaagaccaa
gcttccgatgattcatcgaataaaagtaaagagactgaagatgagaccgaagaggataaa
gaaaatgctttatcacctgatcagtcatcgaagtctaatgaaagtaatgaaccttcaacg
accgaagacaaagaatctaaacaaaatcaatcagcgagcataaaggaatctaatcgagct
tctaaattatctaacatgaactccttattataa

DBGET integrated database retrieval system