KEGG   Auricoccus indicus: BVH56_05705Help
Entry
BVH56_05705       CDS       T04690                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sbac  Auricoccus indicus
Pathway
sbac00020  Citrate cycle (TCA cycle)
sbac00190  Oxidative phosphorylation
sbac00650  Butanoate metabolism
sbac01100  Metabolic pathways
sbac01110  Biosynthesis of secondary metabolites
sbac01120  Microbial metabolism in diverse environments
sbac01130  Biosynthesis of antibiotics
sbac01200  Carbon metabolism
Module
sbac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BVH56_05705
   00650 Butanoate metabolism
    BVH56_05705
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BVH56_05705
Enzymes [BR:sbac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BVH56_05705
    1.3.5.4  fumarate reductase (quinol)
     BVH56_05705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_17 Fer4_2 Fer4 Fer4_16 Fer4_13 Fer4_21 Fer4_15 Fer4_4 Fer4_3 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AQL56448
UniProt: A0A1Q1G269
LinkDB All DBs
Position
complement(1096242..1097060)
Genome map
AA seq 272 aa AA seqDB search
MTQEKTQQSENHEAMNEQKKKQDIRIIVKRQENPDSASYDEEFVIPYRENLNVISALMEI
RRNPVNANGDKTTPVAWDMSCLEEVCGACSMVINGEARQSCTALVDQLAQPIKLEPMSTF
PVVKDLQVDRSFMFDNLKKVKAWVPIDGSYDLGPGPRMPEKKRQTAYELSKCMTCGVCLE
VCPNVNDKSNFIGAQPISQVRLFNLHPTGSMNKDERLHALMMDGGLSACGNSQNCVKACP
KGIPLTTSIAAMNRETTFQMFKSFFGSDHQVD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagaaaaaacacaacaatccgaaaatcatgaagcaatgaatgaacaaaagaaa
aagcaagatattagaattattgttaaaagacaagaaaatcctgatagtgcaagttatgat
gaagaattcgtcatcccttatcgtgagaatttaaatgtcataagtgcattgatggagatt
cgtcgtaatccagttaatgcaaatggtgacaaaacgacaccagttgcatgggatatgagt
tgtttagaagaagtctgtggtgcatgttcaatggtgattaatggtgaagcacgacaatca
tgtacagcattagtagatcaattggctcaaccaatcaagttagagccaatgagtacattc
ccagttgtgaaggacttacaagttgatcgttcgttcatgtttgataacttgaagaaagta
aaagcttgggtgccaattgatggatcttatgatttgggtccaggaccacgtatgccagaa
aagaaacgtcaaacagcttatgaattgtcaaaatgtatgacgtgtggtgtttgtttagaa
gtgtgtcctaacgtaaacgataaatctaatttcatcggagcacagccgatttcacaagtt
cgtttatttaacttacacccaacaggaagcatgaataaagacgaaagacttcatgcgtta
atgatggatggtggtttatctgcatgtggtaactcacaaaactgtgtcaaagcttgtcct
aaaggaattcctttaacgacttctatcgctgcaatgaaccgtgagacaacattccaaatg
tttaagtcattctttggaagtgaccatcaagtcgattaa

DBGET integrated database retrieval system