KEGG   Auricoccus indicus: BVH56_05710Help
Entry
BVH56_05710       CDS       T04690                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sbac  Auricoccus indicus
Pathway
sbac00020  Citrate cycle (TCA cycle)
sbac00190  Oxidative phosphorylation
sbac00650  Butanoate metabolism
sbac01100  Metabolic pathways
sbac01110  Biosynthesis of secondary metabolites
sbac01120  Microbial metabolism in diverse environments
sbac01130  Biosynthesis of antibiotics
sbac01200  Carbon metabolism
Module
sbac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BVH56_05710
   00650 Butanoate metabolism
    BVH56_05710
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BVH56_05710
Enzymes [BR:sbac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BVH56_05710
    1.3.5.4  fumarate reductase (quinol)
     BVH56_05710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like AlaDh_PNT_C GIDA Not3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AQL56449
UniProt: A0A1Q1G2H5
LinkDB All DBs
Position
complement(1097060..1098823)
Genome map
AA seq 587 aa AA seqDB search
MAQNKIIIVGGGLAGLMATIKAAEDGNIVDLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKAMTEAAPSIIHLLDRMGVMFNRTPEGFLDFRRFGGTL
HHRTAFAGATTGQQLLYALDEQVRKHEVNGLVNKYEGHEFLRVVLDDEGRARGIIAQDMK
TAEIKSYKADAVIMATGGPGIIFGKSTNSMINTGSAASIVFQQGAAYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGIYV
DYDQMTTIPGLFAAGECDYSQHGGNRLGANSLLSAIYGGMVAGPNAIKYVEGLDASYEDL
DESIYTRAIEEEQEKWNTILNMNGEENAYMLHKELGEWMTANVTVVRHNDKLQETDKKIQ
ELMERFHNINMDDTKAWSNQGAFFTRQLWNMLELARVITLGAYNRNESRGAHYKPEFPER
NDDEWLKTTKAFYQKGQAPRFEYEEVDVSLIEPRLRDYSKASDGGKK
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaataaaattattattgtcggtggcggattagccggcttaatggcaacaatt
aaagctgccgaagatggcaatatcgtagatttattctcattagtacccgttaagcgttca
cactctgtatgtgctcaaggtggtattaatggagcggtgaacactaaaggtgaaggagac
tcaccatggattcattttgatgatacagtttatggtggagatttcttagcgaaccaacca
ccagttaaagcgatgactgaagcagccccttcgattatccacttacttgatcgtatggga
gttatgtttaatagaacaccagaaggatttttagacttcagacgtttcggtgggacgtta
caccatagaacagcatttgcaggtgctacaactggacaacagttgctttacgcgttggat
gaacaagtgcgtaaacatgaagtaaatggtttagtaaataagtatgaagggcacgaattt
ttacgtgttgttctagatgatgaaggtagagcacgaggaatcatcgcacaagatatgaaa
acagcagagattaaatcatacaaagcagacgcagtcattatggcgacaggtggacctggt
attatctttggtaagtcaacaaactcaatgatcaatactggttctgcagcatcgattgta
ttccaacaaggtgcagcctatgcgaacggtgagttcattcaaatacatccaacagcgatt
cctggtgacgataaattacgtttgatgagtgaatcagcacgtggtgaaggtggccgtgta
tggacttataaagatggcaaaccatggtacttcttagaagagaaatatccagcatatgga
aacttagtacctcgtgatattgcaacacgtgaaatctttgatgtatgtgtgaatcaaaag
cttggaattaatggtgaaaacatggtttatctagacttgtctcataaagatccgcatgag
ttagatgtgaagctcggtggaattattgaaatttatgagaaattcacaggagacgaccca
cgtaaagtgccaatgaagatattcccagctgtgcattattcaatgggtggtatttatgtt
gattatgatcaaatgacaacaattcctggattatttgctgcgggtgaatgtgattattca
cagcatggtggaaatcgtctaggtgcgaattcattattgtctgcgatttatggtggtatg
gttgcaggtccgaatgcaattaaatatgttgaaggactagatgcatcatatgaagatcta
gatgagtcaatttatacgcgtgcaattgaagaagaacaagagaaatggaatacaatatta
aacatgaacggcgaagaaaatgcttatatgttgcataaagaacttggtgaatggatgact
gcgaacgtaacagttgttcgtcataacgacaaattacaagaaacagacaagaaaatccaa
gagttaatggaacgtttccataacattaatatggatgatacgaaagcttggagtaaccaa
ggtgcattctttacgcgtcaattatggaatatgttagagcttgcacgtgtcattacatta
ggtgcatataaccgtaatgaatcacgcggtgcacactacaaaccagaattccctgaacgt
aatgatgatgaatggttgaaaacgacgaaggcgttctaccaaaaaggtcaagcacctaga
tttgaatacgaagaagtcgatgtgagcttaatcgaacctcgtctacgtgactattctaaa
gctagtgatggagggaagaaataa

DBGET integrated database retrieval system