KEGG   Shewanella baltica BA175: Sbal175_0841Help
Entry
Sbal175_0841      CDS       T02014                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00730  Thiamine metabolism
sbb00790  Folate biosynthesis
sbb01100  Metabolic pathways
sbb02020  Two-component system
Module
sbb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Sbal175_0841
   00790 Folate biosynthesis
    Sbal175_0841
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sbal175_0841
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbb04147]
    Sbal175_0841
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sbb00537]
    Sbal175_0841
Enzymes [BR:sbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sbal175_0841
Exosome [BR:sbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal175_0841
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sbb00537]
 Enzymes
  Sbal175_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: AEG10121
UniProt: G0AY13
LinkDB All DBs
Position
complement(996812..998131)
Genome map
AA seq 439 aa AA seqDB search
MSFTKAPLLLLGISLLLSTPVWADETGPTKAPSRPKNIVIMIGDGMGPSYTSAYRYYKDN
PDTEEVEQTVFDRLLVGMASTYPASVSGYVTDSAAAATALATGVKSYNGAISVDTQKQPL
PTILEKAKSLGLSTGVAVTSQINHATPAAFLAHNESRKNYDALALSYLETNADVFLGGGQ
KYFPPALLEQFKAKGYQHISRFEDLASITQPKVLGLFAEVQLPWAIDEKDARKLSTLTQK
ALSLLSQNDQGFVLLVEGSLIDWAGHNNDIATAMGEMDEFSNAIEVVEQFVREHPDTLMV
ITADHNTGGLSIGVDGNYSWNPEILRNISASTDTLALAAITGEQWQADLARGLGFELSEE
EVAKLNVARMQGLETMAVAIRHVIDKRTDTGWTTDGHTGTDVQVFAAGPASELFNGHQDN
TDIANKIFSLLPKPKKPKS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaccaaagcgccactcttgttactcggcatcagtttgctgttatctacgcca
gtttgggcagatgaaacgggtccaacgaaagcgccatcgcgaccgaaaaatatcgtcatc
atgataggtgatggtatggggccgtcttacactagcgcctatcgctattacaaagataat
cctgacactgaagaagtcgaacaaaccgtattcgaccgtttactggtaggcatggcgagt
acctatcccgcgagcgtcagtggttatgtgactgactcagccgccgcggcaaccgcactc
gccactggggtaaaatcctataatggggcgatttcggtcgatacccaaaagcaaccactg
ccgaccatactcgaaaaagccaaatcccttggccttagcacaggggtcgcggtaacgtcg
caaatcaaccacgccacgccagccgcctttttggcccacaacgagagccgtaaaaactac
gacgctctggcactcagctatttagaaaccaacgccgatgtatttttaggcggtggtcaa
aagtattttcctcctgcgctgttagagcagttcaaagccaagggctatcaacacatcagc
cgttttgaggatctcgccagcatcacccaaccaaaagtgttgggcctgtttgccgaagta
caattgccctgggcgattgatgagaaagatgcaagaaaactcagcaccttaactcaaaaa
gcactcagcttactgtcgcaaaatgaccaaggttttgtgttgttagtcgaagggagtctc
atcgactgggcgggccacaataacgacatcgccacagccatgggtgagatggatgaattc
tccaatgccattgaagtggttgagcaatttgtgcgtgaacatcccgataccctgatggtg
atcaccgccgaccacaataccggtggtctatcgattggcgtcgatggcaattacagctgg
aaccctgaaatcctgcgtaatatctcggccagcacagacactttggccttagccgcaatc
actggtgagcaatggcaagccgatctcgcccgcggtttaggctttgaacttagcgaagaa
gaagtcgccaaattgaacgtcgccagaatgcagggattagaaaccatggcggtggcgatt
cgccatgttattgataaacgtactgatacaggttggacaaccgacggtcacacaggcaca
gacgtacaagtttttgccgcaggtccggcgtctgagctgtttaacggccatcaagataat
accgatatcgccaataagatttttagcttattacctaaaccgaagaaacctaaaagctaa

DBGET integrated database retrieval system