KEGG   Shewanella baltica BA175: Sbal175_1859Help
Entry
Sbal175_1859      CDS       T02014                                 

Definition
(GenBank) succinate dehydrogenase, cytochrome b556 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00020  Citrate cycle (TCA cycle)
sbb00190  Oxidative phosphorylation
sbb00650  Butanoate metabolism
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb01200  Carbon metabolism
Module
sbb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal175_1859
   00650 Butanoate metabolism
    Sbal175_1859
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Sbal175_1859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AEG11129
UniProt: G0AWT3
LinkDB All DBs
Position
2197717..2198112
Genome map
AA seq 131 aa AA seqDB search
MELSEQNVKKQRPVHLDLQTIRFPATAIVSILHRVSGVIMLFAVGILIWLLNSSLASAES
FAGVQSLFDNFVMKFIMWGIMTALAYHLFGGLRHLVMDTGRWEELSSGAASAKAVFALTV
AFSIIAGIWVW
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggagctgagtgagcagaacgtgaaaaagcaaagacctgtccatttagatctgcagacc
attcgctttcctgcaacagcgattgtgtcaattcttcaccgtgtttccggtgtcatcatg
ctgttcgcagttggcattctcatttggttgctaaattcatctttagcatcagctgaaagt
ttcgctggcgtacaatctctattcgataacttcgttatgaagttcatcatgtggggcatt
atgactgcactggcgtatcacttgtttggtggcctgcgccacttagtaatggataccggt
cgttgggaagaattgtcatcgggtgccgcatcagcgaaagctgtatttgccttaacggta
gccttttcaatcatagcggggatttgggtatggtaa

DBGET integrated database retrieval system