KEGG   Shewanella baltica BA175: Sbal175_1861Help
Entry
Sbal175_1861      CDS       T02014                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00020  Citrate cycle (TCA cycle)
sbb00190  Oxidative phosphorylation
sbb00650  Butanoate metabolism
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb01200  Carbon metabolism
Module
sbb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal175_1861
   00650 Butanoate metabolism
    Sbal175_1861
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Sbal175_1861
Enzymes [BR:sbb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Sbal175_1861
    1.3.5.4  fumarate reductase (quinol)
     Sbal175_1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C HI0933_like GIDA Pyr_redox_2 DAO FAD_binding_3 FAD_oxidored Thi4
Motif
Other DBs
NCBI-ProteinID: AEG11131
UniProt: G0AWT5
LinkDB All DBs
Position
2198454..2200220
Genome map
AA seq 588 aa AA seqDB search
MSIPVREFDAVVIGAGGAGMRAALQISKEGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDFIGDQEAIEFMCKTGPEAVIELEQMGLPFSRFENGTIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHCLYQQNVKHKTQVFSEWYALDLVKNDDGAVVGC
TAIEIETGDIVYFKAKATILATGGAGRIYASTTNAHINTGDGVGMAMRAGVQMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLASRDVVARSMMTEIREG
RGLDGPLGPHCLLKLDHLGKETLEARLPGVCELSRTFAHIDPADGPIPVLPTCHYMMGGL
PTKVSGQVIRKNEDGTEHDVIGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGQHLG
KALDETDDPKDASDADIQASLARLNRWESNKDGEDPAQIRKDLQLCMQLNFSVFRRGDAM
AEGLEQLKVIRERLANAKLSDNSREFNTQRIECLELDNLMATAIATAYAANFRTESRGAH
SREDYLERDDENWLCHSLFDPITETMDRRAVNMAPKLREAFPPKKRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattccagtacgcgaatttgatgctgtagtgatcggtgccggtggcgctggtatg
cgtgcagcgctgcagatttccaaagaaggtaaaagctgtgcgcttttatcaaaagtattc
ccaactcgttctcataccgtatctgcgcagggtggtatcactgttgcgttaggtaacgcc
catgaagatcattgggaacagcatatgtatgataccgtgaaaggttccgattttatcggt
gaccaagaagcgattgaattcatgtgtaaaaccggtcctgaagccgtgattgaacttgag
caaatgggtttgcctttctctcgtttcgaaaatggcacgatttaccaacgtccgtttggt
ggtcaatctaagaactttggtggcgagcaggctgcacgtactgcggcagctgccgaccgt
actggtcatgctttgctgcactgtttataccaacaaaacgttaagcataagacgcaagtc
ttctcagaatggtatgcattagatctcgttaaaaacgatgatggcgccgttgtgggttgt
actgcgattgaaattgaaacaggcgatatcgtttatttcaaagccaaagcaacgattctt
gcgacaggtggagcagggcgtatttacgcttcgaccactaacgcgcatatcaacaccggt
gacggcgtcggtatggcaatgcgtgctggcgtgcaaatgcaagacatggaaatgtggcaa
ttccacccaactggcatcgccggcgcgggtgtacttgtgactgaaggttgtcgtggtgaa
ggcggttatctgctgaacaaagacggcgagcgcttcatggagcgttatgcccctaacgcg
aaagatttggcatcacgcgacgtggtagcacgttctatgatgactgaaatccgcgaaggt
cgtggtttagacggtccattaggtccacactgtttactcaagcttgatcacttaggtaaa
gaaacattagaagcacgtttaccaggcgtgtgtgaattgtctcgtacctttgcccatatc
gatccggccgatggtccaatcccagtattaccaacctgtcactacatgatgggcggtctg
ccaactaaggtcagtggtcaagttattcgtaagaatgaagacggcactgaacatgatgtt
atcggtctgtttgctgtgggtgagattgcctgtgtatctgttcacggtgcaaaccgctta
ggtggtaactcattgctcgacttagtggtctttggccgcgcagcgggtcagcatttaggt
aaagctttggatgagacagacgatccaaaagacgcaagcgatgcggatattcaagcatct
ctggcgcgtctgaatcgttgggaaagcaacaaagatggcgaagatccagcgcaaatccgt
aaggatctgcagctgtgtatgcaattaaacttctctgtattccgtcgtggcgatgctatg
gctgaaggtttagagcagttgaaagtgatccgcgaacgtcttgcaaatgctaaattgtct
gataactctcgtgaattcaacactcaacgtattgaatgcttagagttagataacttaatg
gcaacggcgattgcaacggcttatgcggctaacttccgtactgaaagccgcggtgctcac
tcacgtgaagattatttagagcgtgatgatgagaactggttatgccacagcttatttgac
ccaatcactgaaacgatggatcgtcgtgcagtgaacatggcacctaagttacgtgaagca
ttcccgccgaagaaacgtacctactag

DBGET integrated database retrieval system