KEGG   Shewanella baltica BA175: Sbal175_1862Help
Entry
Sbal175_1862      CDS       T02014                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00020  Citrate cycle (TCA cycle)
sbb00190  Oxidative phosphorylation
sbb00650  Butanoate metabolism
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb01200  Carbon metabolism
Module
sbb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal175_1862
   00650 Butanoate metabolism
    Sbal175_1862
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Sbal175_1862
Enzymes [BR:sbb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Sbal175_1862
    1.3.5.4  fumarate reductase (quinol)
     Sbal175_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AEG11132
UniProt: G0AWT6
LinkDB All DBs
Position
2200232..2200939
Genome map
AA seq 235 aa AA seqDB search
MKLTFAVYRYNPDVDTKPYMQDYTLEVAEGSDMMVLDALIKLKEQDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPISTFKGKKLEIRPLPGMPVVRDLVVDLTQFYKQYEKIKPYLI
NDEKAPAREHLQSPEERAHLDGLYECIMCACCSTACPSFWWNPDKFIGPSGLLHAYRFLI
DSRDTATEERLSELDDAYSVFRCHGIMNCVDVCPKGLNPTKAIGHIKSMLLKRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgacatttgcagtttatcgctacaatcctgacgtagatactaaaccgtatatg
caggattacaccttagaagtggctgaaggctctgacatgatggtgctcgatgcactgatc
aagttaaaagagcaagatccgactctgtcattccgtcgctcatgccgtgaaggtgtgtgt
ggttctgacggcgtgaacatgaatggtaagaatggtctggcgtgtattaccccaatttca
acctttaaaggcaagaaattagaaatacgtccattaccaggtatgccagttgttcgcgac
ttagttgttgatttaactcagttctataagcagtatgagaagatcaagccttacctcatc
aatgatgagaaagcaccagcccgtgaacacttacaatcacctgaagagcgtgctcattta
gatggtctgtacgaatgtatcatgtgtgcctgttgttcaacggcttgcccatcattctgg
tggaatcctgataagtttatcggtccaagcggtctgcttcacgcatatcgtttcttgatc
gacagtcgcgatacagcaacagaagaacgtttatctgagctggacgacgcctatagcgtg
ttccgttgccacggcatcatgaactgcgttgacgtttgtccaaaaggtcttaatccgact
aaagcaattggtcatattaagtccatgctgttgaagcgagcagtgtaa

DBGET integrated database retrieval system