KEGG   Shewanella baltica BA175: Sbal175_2759Help
Entry
Sbal175_2759      CDS       T02014                                 

Definition
(GenBank) putative pyridoxal-dependent aspartate 1-decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00250  Alanine, aspartate and glutamate metabolism
sbb00410  beta-Alanine metabolism
sbb00430  Taurine and hypotaurine metabolism
sbb00650  Butanoate metabolism
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb02024  Quorum sensing
Module
sbb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Sbal175_2759
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sbal175_2759
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sbal175_2759
   00430 Taurine and hypotaurine metabolism
    Sbal175_2759
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sbal175_2759
Enzymes [BR:sbb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Sbal175_2759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 P53_tetramer
Motif
Other DBs
NCBI-ProteinID: AEG12003
UniProt: G0ASU8
LinkDB All DBs
Position
3255374..3257023
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQATASEESLLRIFTAPEDAGSTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPTQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYDQDTDFYQSWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGEFKGVSREGLLKALRHYGYDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTGRDNKVDVAKMRQAALELASKNIKVLAIVGVAGTTETGNVDPLTELAALAKEL
NCHFHVDAAWGGASLLSNKYRHLLAGIELADSVTIDAHKQMYVPMGAGMVLFKDPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIKAHEDFELVTEPELCLLTYRYVPACVQAAMQLACEQADTLRLARFNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQATVVFRVVLANPLTSHDILNQVLIEQSEIAALDNEFL
PALLAMVAE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaaactccctcgccaagccacagcatccgaagaaagtctgctccgcattttt
actgcgccggaagatgcaggatcaacgctgagtattatcgagcagaagctctccgaggac
ttagcaggctttttgggtgacagtatcgccgcgctcgaaaaacccttgtcggaaattgaa
accgattttcaagcctttgagatcccaactcagccgcgtttcgtctccgattacaccgac
gagattatgcaaaatctggtggcgcattcggtacacacagcggcaccaagttttatcggc
cacatgacgtcggcactgccctactttgtgttgccgctgtcgaaaatgatggtgggactc
aatcaaaatctggtcaaaatcgaaacctcgaaggcttttacgccgcttgagcgccaagtg
ctcggcatgatgcaccatttgatttacgaccaagatacggatttttatcaaagctggatg
cacagcgccaatcattccctcggcgcattttgctccggcggcacagtggccaacattacg
gccctgtggattgcccgcaaccaattattgaaagccgatggcgagtttaaaggcgtcagc
cgcgaagggttactcaaggcgttgcgccactacggctatgacgatttagcgattttagtc
tctgagcgcggtcactattcgctgggcaaagccgtcgatctgcttggtatcggccgcgac
aatatcatcagcattcccacgggccgcgataacaaggtcgatgtcgcgaaaatgcgccaa
gccgcccttgaacttgccagtaaaaacatcaaagtgttggcgattgttggcgtggctggc
accacagaaaccggtaatgttgatccactgacagaattagcggcgctggcaaaagagtta
aattgtcatttccatgtagatgcagcgtggggcggagcaagtttattatccaataaatac
cgccacttactcgcaggtatcgaacttgccgattcagtcaccatcgatgcccacaaacaa
atgtacgtgcctatgggcgcgggcatggtgttatttaaagacccagagttcgcccacgcc
attgcccatcacgccgaatatattttgcgccgtggttcaaaggacttaggcagccaaacg
ctggaaggttcacgccccggcatggcgatgttagtgcacgcttgcttacagatcatcggc
cgcgatgggtatgaaatcttaatcaataacagccttgaaaaagcgcgttattttgccgaa
caaatcaaagcccatgaggattttgaactggttactgaaccagaactgtgtctgctgact
tatcgttatgtgcccgcatgcgtccaagccgccatgcagcttgcctgtgagcaagcagac
accttaagactcgcccgctttaatgagctgctcgatggcctcacccagtttattcaaaag
caccaacgcgaacagggtaaatccttcgtctcccgcacccgcattcagccagcccgctat
tttaggcaagcgaccgtggtgtttcgcgtagtactcgctaaccccctcaccagccatgac
atcctcaatcaagtgctaatcgaacaaagcgaaatcgccgcattagataatgagttttta
cctgcgttattggcaatggttgctgaatag

DBGET integrated database retrieval system