KEGG   Shewanella baltica BA175: Sbal175_2889Help
Entry
Sbal175_2889      CDS       T02014                                 

Definition
(GenBank) PTS system, glucose-like IIB subunint
  KO
K02778  PTS system, glucose-specific IIB component [EC:2.7.1.199]
K02779  PTS system, glucose-specific IIC component
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00010  Glycolysis / Gluconeogenesis
sbb00520  Amino sugar and nucleotide sugar metabolism
sbb01100  Metabolic pathways
sbb02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal175_2889
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal175_2889
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Sbal175_2889
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbb02000]
    Sbal175_2889
Enzymes [BR:sbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.199  protein-Npi-phosphohistidine---D-glucose phosphotransferase
     Sbal175_2889
Transporters [BR:sbb02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    Sbal175_2889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_EIIB JAMP
Motif
Other DBs
NCBI-ProteinID: AEG12128
UniProt: G0AUG6
LinkDB All DBs
Position
complement(3410047..3411534)
Genome map
AA seq 495 aa AA seqDB search
MARTLESSRQNRARRLGSFVTQQWFKFAQRLSQALLIPIAILPAAGVMLGLTVSPIPFMP
EELTVLMLAVGKLIFAIMPMLFAVAVAIGFCRDQGIAAFTAVFGYGVMTATLAALADLYR
LPTQPLLGMDTLDTGIAGGMMLGGITCLAVRWSQYIRLPAIFSFFEGRRSASLLIIPLAM
GLGYVLAHVWPPLALLIERVSDWAVYQKPAIAFGVYGALERLLIPLGLHHIWNAPFYLEV
GQYQLLGHEVVRGEVARYLAGDPQAGNLAGGYLIKMWGLPAAALAMWRCADPSERNRVAG
IMLSAGAASWLTGVTEPIEFAFMFVAPILFIIHALLTGLAYFVCIMLDIHHSIVFSQGLV
DFTLLFPLSRNASWFIFLGPLTAIIYYLLFRLSILAFNLKTPGRLEHNDSDSKGPKESLR
AIIAALGGRDNIVELNACLTRLRLSVHKPELVNKVRLSQLGAKGVIVMGKGVQVVYGTKA
ETLRKVLQRYLDTRR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggctagaacgctggaatcaagtcgtcaaaaccgagctcgtcgcttaggcagtttcgtt
actcagcagtggtttaaatttgcccagcgcttaagccaagcgctgcttattcctattgcc
attttgcccgccgctggggtcatgcttggcctcaccgttagtcctattccttttatgccc
gaagagcttacagtgttgatgttggcggtgggcaaactcattttcgccatcatgccgatg
ttatttgccgtggcggtcgctattggcttttgccgcgatcaaggcattgccgcctttacg
gcggtgtttggttatggagtgatgacggcgacattagccgcactggctgatttgtaccgt
ctcccaacccagcctttattggggatggataccttagatactgggattgcgggtggcatg
atgctcggcggtattacttgtcttgcggtgcgctggagtcaatatatacgtttgcctgcg
attttctccttctttgagggacgtcgcagtgcatctttacttattattcccctagcgatg
ggcttaggttatgtgctcgcccatgtgtggccacccttagcgctattgattgagcgagta
tctgattgggcagtttatcaaaaaccggccattgcttttggcgtgtatggcgcattagag
cgattacttattccccttggcttgcaccatatttggaatgcgcctttttacttagaagtg
ggccaatatcagttattaggacatgaagtcgtccgtggtgaggtggcacgttatttagcg
ggcgatccgcaggcgggaaaccttgctggtggttatctgattaaaatgtggggattacct
gcggcggcactggcaatgtggcgctgcgccgatccttctgagcgtaatcgcgtggcgggc
attatgctctcggcgggggcggctagttggttaacaggggtgactgaacctatcgaattt
gcctttatgtttgtggcgccaatcctatttatcattcacgccttactcactgggctcgct
tactttgtctgtatcatgctcgatattcaccacagcatagtgttctcccaagggctggtg
gactttacgttgttatttccattgtcccgtaatgccagctggtttattttcctcggacct
ttgaccgccatcatatattacctgttgtttaggttgagtattttagcctttaatttgaaa
acgcccggcaggcttgagcataacgacagtgacagtaaaggacctaaagaaagtttacgg
gcgattattgcggcgcttggtgggcgtgacaatatcgttgagctgaatgcctgtttaact
cggttacgcttgagcgtacataagccagagttagtcaataaggtgcgtttgagtcagttg
ggcgctaagggcgtgatcgttatgggcaaaggtgtgcaggtggtttatggcactaaggcc
gaaaccctgcgtaaagtattgcagcgttacttagatactcgccgctag

DBGET integrated database retrieval system