KEGG   Shewanella baltica BA175: Sbal175_3424Help
Entry
Sbal175_3424      CDS       T02014                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sbb  Shewanella baltica BA175
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sbal175_3424
Enzymes [BR:sbb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sbal175_3424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO NAD_binding_7 Thi4 Glutaredoxin AlaDh_PNT_C FMO-like K_oxygenase NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEG12658
UniProt: G0AZP8
LinkDB All DBs
Position
4064116..4065687
Genome map
AA seq 523 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLAQDIVSLSSLVSLKETQGERT
PAMTVINPQLNTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDDIIEQIRNLPGKYAFE
TYVSLTCQNCPDVVQALNMMAAINPNITNVMIDGALFQDEVVSRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTNAASRKADEINEKAPFEVLVVGGGPAGAAAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVSLGTDGLFELE
LASGAKLRSRTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDKILRADDVLQRKAASMGNIKIITQAMTTEVTGDGTRVNG
LNYTDRATGESHHVALAGIFVQIGLVPNTEWLKGVVELTPRGEIIVDARGQTSIPGVFAA
GDVTDTPFKQIIIAMGSGASASLGAFDYLIRHSDEEIAETKAA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttaaaaaatcaactgcaaacctatctgcaaaacctcaagagacca
gttgaacttgtcgtatctgcagatgagagcaaaaagtctcaagaattaaaaagcttagcg
caagacattgtcagcctatcttctctggtgagcctgaaagaaactcagggcgaacgcacc
ccggcgatgacagtgataaacccacaacttaatacgcaaatcagctttgctggtctgcct
atgggtcacgaatttacctcacttgtgttggccttactgcacacgggtggacacccaatc
aaactcagcgatgacattatcgagcagatccgcaatctgccgggcaaatatgcctttgaa
acttacgtctcactgacctgccaaaactgcccagacgtagtacaggcactgaacatgatg
gcggcgattaacccgaatatcaccaacgtgatgatcgacggcgccctgttccaagacgaa
gtggtgagccgtaacattatggccgtgccttctgtctacttaaatggcgaagtatttgca
gccggtcgtatcagcattggtgagatccttaataaactggataccaatgccgcaagccgc
aaggccgatgaaatcaatgaaaaagcgccattcgaagtcttagtggtaggcggcggccca
gcgggcgcagcggccgctatttacgcagcacgtaaaggccttcgcacaggtattgttgcc
gacaaatttggcggacaagtggctgaaacggttggtatcgagaactttatttcagtcaaa
gcgaccgaaggtccgaagctagtggcaaaccttgaagcccatgtacgagactacgaagtc
gacatcatggacaaccaaaaggcagtttctttaggcacagatggcttgttcgagcttgaa
ctggcaagcggcgctaaattacgtagccgtaccgtattgttagccacaggtgcgcgctgg
cgtgaaatgaatgtccccggcgagaaagaataccgtggtaaaggtgtcgcatactgcccg
cattgcgatggcccgttatttaaaggcaagcgtgtggcggtgattggcggcggtaactca
ggtatcgaagcggctatcgatcttgccaacatagtagaacatgtgactgtgctggagttt
gataaaatcctacgcgccgacgatgtgctacaacgtaaagcagcgtctatgggtaacatc
aaaatcattacccaagcgatgaccacagaagtgactggcgatggcactcgggttaatggc
ctgaactacacagacagagcaacgggcgagagtcaccatgtcgcacttgcaggtatcttc
gtacagattgggctagtgccgaataccgagtggctaaaaggtgtggttgaactgacgcca
cgtggggaaatcattgtcgatgcccgcggtcaaacatccatccctggagtatttgcggca
ggcgatgtcactgacacgccgtttaagcaaattatcatcgccatgggcagcggtgcgagt
gcatcactgggcgcatttgattacttaattcgtcacagcgatgaagaaatcgccgaaacc
aaagcagcttaa

DBGET integrated database retrieval system