KEGG   Shigella boydii CDC 3083-94 (serotype 18): SbBS512_A0150
Entry
SbBS512_A0150     CDS       T00700                                 

Definition
(GenBank) IpaJ, invasion plasmid antigen
  KO
K23832  cysteine protease IpaJ [EC:3.4.22.-]
Organism
sbc  Shigella boydii CDC 3083-94 (serotype 18)
Pathway
sbc05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sbc00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SbBS512_A0150
Enzymes [BR:sbc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     SbBS512_A0150
SSDB
Other DBs
NCBI-ProteinID: ACD06254
UniProt: B2TSW7
LinkDB
Position
pBS512_211:99340..100119
AA seq 259 aa
MSEQRKPCKRGCIHTGVMLYGVLLQGAIPREYMISHQTDVRVNENRVNEQGCFLARKQMY
DNSCGAASLLCAAKELGVDKIPQYKGSMSEMTRKSSLDLDNRCERDLYLITSGNYNPRIH
KDNIADAGYSMPDKIVMATRLLGLNAYVVEESNIFSQVISFIYPDARDLLIGMGCNIVHQ
RDVLSSNQRVLEAVAVSFIGVPVGLHWVLCRPDGSYMDPAVGENYSCFSTMELGARRSNS
NFIGYTKIGISIVITNEAL
NT seq 780 nt   +upstreamnt  +downstreamnt
atgtcggaacaacggaagccttgcaaacggggatgtattcatacaggtgttatgttatat
ggggttttattgcagggggctataccaagagaatatatgatatctcatcagactgatgtg
agggtaaatgagaatagagtaaacgaacaaggttgttttttggcgaggaagcagatgtat
gacaattcttgtggagctgccagtttactctgtgccgcaaaggaattaggggttgataaa
ataccacaatacaaagggtctatgtccgaaatgacaaggaagagttctcttgatttggat
aatcgttgtgagcgggatttatacttaataactagtggtaattataatccgagaatacac
aaagataatatcgcggatgccggttattctatgcctgataagatagtcatggctacgagg
cttcttggattgaatgcttatgtcgttgaagaaagtaacattttttcgcaagtaattagt
tttatttatcccgatgcaagggacttattaattggcatgggatgtaatatagtacatcaa
cgagatgtgttatcttctaaccaaagagttttggaagctgttgctgtatcctttattgga
gttcctgtcggcctccactgggtgttgtgtagacctgatggaagctatatggatccagct
gtaggagaaaattattcttgtttttcaactatggaattaggtgcaagaagaagtaattct
aactttataggatatactaaaataggtatttccatagttataactaatgaggctttgtaa

DBGET integrated database retrieval system