KEGG   Shigella boydii CDC 3083-94 (serotype 18): SbBS512_A0311
Entry
SbBS512_A0311     CDS       T00700                                 

Definition
(GenBank) protease 7
  KO
K13520  outer membrane protease [EC:3.4.23.-]
Organism
sbc  Shigella boydii CDC 3083-94 (serotype 18)
Pathway
sbc05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sbc00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SbBS512_A0311
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbc01002]
    SbBS512_A0311
Enzymes [BR:sbc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     SbBS512_A0311
Peptidases and inhibitors [BR:sbc01002]
 Aspartic peptidases
  Family A26: omptin family
   SbBS512_A0311
SSDB
Motif
Pfam: Omptin
Other DBs
NCBI-ProteinID: ACD06162
UniProt: B2TTA0
LinkDB
Position
pBS512_211:208301..209281
AA seq 326 aa
MDISTKKVEFSMKLKFLVLALCVPAIFTTHATTNYPLFIPDNISTDISLGSLSGKTKERV
YHPKEGGRKISQLDWKYSNATIVRGGIDWKLIPKVSFGVSGWTTLGNQKASMVDKDWNNS
NTPQVWTDQSWHPNTHLRDANEFELNLKGWLLNNLDYRLGLIAGYQESRYSFNAMGGSYI
YSENGGNRNKKGAHPSGERTIGYKQLFKIPYIGLTANYRHENFEFGAELKYSGWVRSSDT
DKHYQTETIFKDEIKNQNYCSVAANIGYYVTPSAKFYIEGSRNYISNKKGDTSLYEQSTN
ISGTIKNSASIEYIGFLTSAGIKYIF
NT seq 981 nt   +upstreamnt  +downstreamnt
atggacatttcaaccaaaaaagtagagttctcgatgaaattaaaattccttgtacttgca
ctttgtgtacctgcgatctttactacacatgctaccactaactatccacttttcataccg
gataacatcagtacggatattagtctaggatctctgagtggcaaaacaaaagaacgcgtt
tatcatcccaaggaaggggggagaaaaattagtcaactggactggaaatacagtaatgcg
actattgttagaggtggcatcgattggaagctaattccaaaagtgtctttcggagtttcc
ggttggactactttaggtaaccagaaagcaagcatggttgataaagactggaacaattcc
aatacccctcaggtatggaccgaccagagctggcatcccaatacgcatctccgtgatgct
aacgaattcgagctgaatcttaaaggttggttattaaataatttggattatcgacttgga
ctaatagcaggttaccaagagagtcgttacagttttaatgcaatgggagggagttatatt
tatagtgaaaacggggggaacaggaataaaaaaggggcacatcctagtggtgaaagaaca
ataggttacaaacagctcttcaaaataccttatattggattaactgctaattaccgccat
gagaattttgagtttggagcagaactgaaatatagtggttgggttcgttcatctgataca
gataaacactatcagactgagacaatttttaaagatgaaataaaaaaccaaaattactgc
tctgttgctgcgaatattggatactatgtcacccccagtgcaaaattttatatagaaggc
tccagaaattacatttctaataaaaaaggtgatacatctctttatgagcaaagtaccaat
atatctggcaccattaaaaatagtgcaagtattgaatatattggttttctcacttccgca
ggtataaagtatattttttga

DBGET integrated database retrieval system