KEGG   Sphingobium baderi: ATN00_09200Help
Entry
ATN00_09200       CDS       T04194                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sbd  Sphingobium baderi
Brite
KEGG Orthology (KO) [BR:sbd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ATN00_09200
Enzymes [BR:sbd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ATN00_09200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_3 FAD_binding_2 AlaDh_PNT_C NAD_binding_7 Glutaredoxin DAO Thi4 FMO-like K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ALR20456
UniProt: A0A0S3EYE4
LinkDB All DBs
Position
complement(1849944..1851527)
Genome map
AA seq 527 aa AA seqDB search
MLDVNLKGQLKGYLANITQPIELVASLDDGAKSREMQELLNEIAELSDKVAVVRADDDKR
KPSFLIRRVGTDIGVRFAGLPMGHEFTSLVLALLQVGGHPSKAARDLIQQIKDLDGDFAF
ETYFSLSCQNCPDVVQALNLMSVLNPRISHVAIDGALFQQEVDARKVMAVPTVFLNGEPF
ASGRMELEQIVAKIDSGAADRAAEKIKAQDPFEVLIVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVPHTEGPKLAAQLEQHVKDYDVEIMNLQKAAQLIPAKTEGG
YHEVVLENGASLKGRTVILSTGARWRQMGVPGEDDYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVKIITSALTTQVHGDG
NKVTGLSYKDRNHGTEHDVELEGIFVQIGLVPNTEWLKDAVSLSPRGEIEIDARGETSQP
GIFAAGDCTTVPYKQIVIAMGAGSTAALSAFDYMIRLPASEEAAEAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgtaaatctcaaaggacagctcaagggctatctggcgaacatcacccagccg
atcgagttggtagcttcgctggatgacggcgcgaaatcgcgtgaaatgcaggaacttttg
aacgaaatcgccgaactgtcggacaaggttgccgtggttcgcgccgatgacgacaagcgc
aaacccagcttcctcatccgccgggtgggcactgatatcggcgtgcgctttgcgggcctg
ccgatggggcatgaattcacgtcactggtactcgccttgctccaggtcggcggtcatccg
tcgaaggccgcgcgggatcttatccagcagatcaaagatctggacggcgacttcgccttc
gaaacttatttctcgctttcctgccagaactgcccggacgtggtgcaggcactgaacctg
atgagcgtgcttaacccccgcatcagccatgtcgccatcgacggcgcgctgttccagcag
gaagtcgatgcgcgcaaggtgatggcggtgcccaccgtcttcctgaacggagagcctttc
gcttcgggtcgcatggaactggagcagatcgtcgcgaaaattgacagtggcgcggccgat
cgcgcggcagagaagatcaaggcacaagaccccttcgaagtgctgatcgtcggcggtggc
cccgctggcgcagcggcggctatctatgccgcgcgcaagggtatccgcaccggcgtcgcg
gcggagcggttcggtggccaggtgctcgacactatggcgatcgaaaatttcatctccgtc
ccccataccgagggaccgaagctggccgcgcagttggagcagcacgtcaaggactatgac
gtggagatcatgaaccttcagaaggcggcgcagctgatcccggccaagaccgaaggcggc
tatcatgaggtagtgctggaaaatggcgcgtcgctgaaggggcgcaccgtgatcctctcc
accggcgcgcgctggcggcagatgggcgtgccgggtgaagacgactatcgcaacaagggc
gtagcttattgcccacattgcgacggcccgttgttcaaaggcaagcgcgtggccgtgatt
ggcggcggcaatagcggcgtcgaagcagccatcgaccttgccggcatcgtcgcccatgtg
acgctgatcgaattcgacagccagttgcgggccgacgcggtactccagcgcaagttggcc
agcctgcccaatgtgaagatcatcacctcggcgctgaccacgcaggtgcatggcgacggc
aacaaggtgacgggtctcagctacaaggatcgcaatcatggcaccgaacatgatgtcgaa
cttgagggcattttcgttcagatcggactcgtccccaacaccgaatggctgaaggatgca
gtctccctgtccccacgcggcgagatcgagatcgatgcccgcggtgaaaccagtcagccc
ggcatattcgcggcgggcgactgcacgaccgtgccctacaagcagatcgtcattgccatg
ggcgcaggatcgacggcggcgctttccgccttcgactatatgatccgcctccccgccagt
gaggaagcggccgaggcggcctga

DBGET integrated database retrieval system