KEGG   Sphingobium baderi: ATN00_09225Help
Entry
ATN00_09225       CDS       T04194                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sbd  Sphingobium baderi
Pathway
sbd00790  Folate biosynthesis
sbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ATN00_09225
Enzymes [BR:sbd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ATN00_09225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ALR20461
UniProt: A0A0S3EYD5
LinkDB All DBs
Position
1854757..1855881
Genome map
AA seq 374 aa AA seqDB search
MNLPDIPADARLYLKPTWFVPSPIGLPDGAAARMSNGLIWFQGYELTARRNGERIVRVTI
PVDSFADALVSLPESLTERAHSLAANISAQRSPLMLGERTIRFDAPQVMAILNVTPDSFS
DGGKYMEDPNAAADAGFAMASAGAALIDIGGESTRPRAEKIWEGDEIARIVPVIERLAMA
GVSVSVDTRKAAVMEAALAAGAKVVNDVSALRYDPRSMEVVAAAKCPVILMHAPSAGDDP
HDNPAGYRDVVAEVFDMLEERIEACVAGGIARDRIMVDPGLGFGKGLADNLALVNGLATF
QGLGVPLLFAGSRKRLIGALSNEAAASERLGGSIALAFRAAEQGAQMVRVHDVKESVQAL
HLWRGLADAGLSAV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcccgatattcccgccgacgcccggctatacctcaagccgacatggttcgtg
ccgtcgcccatcggattgccggacggggcggcagcgcgcatgagcaatgggctaatctgg
ttccagggctatgaactgacggcgcggcgaaatggcgagcggatagtgcgcgtgacgatt
ccggtcgacagttttgctgacgctctggtgagtttgccggagtcgttgaccgagcgggca
cacagtctggccgcgaatatttctgcccagcgctctccgctgatgcttggcgagcgaact
atccggtttgatgcgccgcaggttatggcaatcctgaacgtgacgccggatagcttttcc
gatggcggcaaatatatggaagaccccaatgcggcggcagatgcaggcttcgccatggca
tcggctggggccgcattgatcgacataggcggagaatccacccgcccgcgcgccgagaag
atatgggaaggcgatgagatcgcccgcatcgttcccgttatcgaacggttggcgatggct
ggcgtgtccgtatcggtcgacacgcgcaaggccgcggtgatggaggcggcgctcgccgca
ggggcgaaggtcgtcaacgatgtgagcgcgctgcggtacgatccgcgcagcatggaggtc
gtggcggcggcgaaatgcccggtgatattgatgcacgcgccttcggccggggacgatccg
catgacaatccggctggctatcgtgacgtcgtggcggaagttttcgacatgctggaagaa
cggatagaggcctgcgtggcgggggggatcgcacgggacaggatcatggtcgatccgggc
ctgggcttcggcaagggacttgcggataatctggcgctcgtcaatgggctggcgacgttt
cagggactgggcgtgccattgctctttgcgggaagtcgcaagcgtttgattggtgcgctc
tccaacgaagcggctgcttccgaaaggctgggcggatcaatcgccctggcatttcgcgcg
gccgagcagggcgcccagatggtgcgcgtccatgacgtcaaggaaagtgttcaggcactg
cacctttggcgcggccttgccgatgcaggattgagcgccgtctaa

DBGET integrated database retrieval system