KEGG   Sphingobium baderi: ATN00_09465Help
Entry
ATN00_09465       CDS       T04194                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbd  Sphingobium baderi
Pathway
sbd00473  D-Alanine metabolism
sbd00550  Peptidoglycan biosynthesis
sbd01100  Metabolic pathways
sbd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ATN00_09465
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ATN00_09465
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ATN00_09465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbd01011]
    ATN00_09465
Enzymes [BR:sbd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ATN00_09465
Peptidoglycan biosynthesis and degradation proteins [BR:sbd01011]
 Precursor biosynthesis
  Amino acid ligase
   ATN00_09465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ALR20498
UniProt: A0A0S3EYL4
LinkDB All DBs
Position
1901055..1902011
Genome map
AA seq 318 aa AA seqDB search
MSRGPWHVAVLMGGWSAERPVSLSSGEGVAKALESRGHKVTRIDMDRDVALRLAETKPDV
VFNALHGVPGEDGTVQGMMDLMGLTYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGQVV
QSESLFEGDPLPRPYVVKPVNEGSSVGVAIVTEGGNYGSPVGRDVEGPWLHFEELLAEPY
IRGRELTTAVLGEEALLVTELRPKSGFYDFDAKYTDGMTEHVCPANIPDDIAQACKAISL
RAHKLLGCRGASRSDFRWDDSQGIDGLFLLEVNTQPGMTPLSLVPEQAAKLGIDYAELVE
RIVEDALKTGAKMGALHE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggggtccgtggcatgtcgccgtcctgatgggcggatggtcggcggagcgcccc
gtctcgctgtcgagcggggaaggcgtggcgaaggcgctggaatcccgcgggcacaaggtt
acgcggatcgacatggatcgcgacgtcgcgctgcgccttgcggaaacgaagcccgatgtc
gtgttcaacgccctgcacggcgttccgggcgaggacgggacggtgcaaggcatgatggac
ctgatggggctcacctacactcattcgggtctcgccacttcggtcatcgccatcgacaag
caactcaccaaacaggcgctcgtgccgcatggcatccccatgcccggcgggcaggtggta
cagagtgagagcttgttcgagggcgatcccctgccgcgtccctatgtcgtgaagccagtc
aatgaaggcagctccgtcggcgtcgccatcgtgaccgagggcggcaattatggctcgcct
gtcggccgcgatgtggaagggccgtggctgcatttcgaagagttgctggccgaaccctat
atccggggccgggaactgacgaccgcagttctgggtgaagaggcgctgctggtcacggaa
ttgcggcccaagagcggtttctatgatttcgacgccaaatataccgacggcatgactgag
catgtctgccccgccaacatccctgacgacatcgcgcaggcgtgcaaggcgatctcgctg
cgcgcccacaagctgttgggttgcaggggggcgtcacgttccgacttccgctgggacgac
tcgcagggtatcgatggcttgttcctgctggaggtcaatacgcagccgggcatgacgcca
ctcagcctcgtgcctgaacaggcggcgaagctgggcattgattatgcggaactggtcgag
cggatcgtggaggatgcgctgaaaacgggggcgaaaatgggggctttgcatgagtga

DBGET integrated database retrieval system