KEGG   Sphingobium baderi: ATN00_13785Help
Entry
ATN00_13785       CDS       T04194                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sbd  Sphingobium baderi
Brite
Enzymes [BR:sbd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     ATN00_13785
Peptidases [BR:sbd01002]
 Metallo Peptidases
  Family M2
   ATN00_13785
Exosome [BR:sbd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ATN00_13785
CD molecules [BR:sbd04090]
 Proteins
  ATN00_13785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ALR21201
UniProt: A0A0S3F0I9
LinkDB All DBs
Position
2821924..2823738
Genome map
AA seq 604 aa AA seqDB search
MKMLASMAVLSAALVVSPAVAQQETTPPATNANAFLEKAEKAMFDQSLVQNHADWINATY
INDDSDALAAYFGAIRTRMTVDYALEAAKFADAPGLSAETKRRLLMLRTALTLPAPTTSG
AADELNSLATSLQSAYGKGKGTLRGQPINGSDIEAAMGTSRNPDELKEMWVSWHDNVGAP
MRQDYTELVSIANAGAKELGFADTGAMWRSKYDMPADDFAKLTDRIWAEVKPLYNDLHCY
TRTKLNEKYGNPVQPDNGPIRADLLGNMWAQEWGNIYDIVAPKGIGDLGYDIGDLLTARG
YDPIKMVKAGEGFYSSLGFKPLPQTFWDRSQIVKPRDRDVVCHASAWDLDNKDDIRIKMC
TKVNSDDFVTIHHELGHNYYQRAYQNHPYLYLDGANDGFHEAIGDFVALSITPDYLVKIG
LLDATKVPGPDKDMGLLLRQAMDKVAFLPFGLLIDKWRWGVFDGTIAPDHYEQAWNDLRR
QYQGIVPPVSRDETAFDPGAKFHIPGNTPYTRYFLARVLQFQFYETACRQAGWKGPLHRC
SFYGNKAVGQKLNTMLEMGASKPWPDALQAFTGQRDISGKALLAYFAPLQKWLQEQNKGK
SCGW
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcttgcttccatggccgtgctttcggccgcgctcgtcgtttccccggccgtg
gcccagcaggagacgacgcctccggccaccaacgccaacgctttcctcgaaaaggcggaa
aaggcgatgttcgatcagtcattggttcaaaaccatgcggactggatcaatgccacctac
atcaatgacgatagcgacgcgctggccgcttatttcggggcgatccgcacgcgaatgaca
gtggactatgcgctggaggcggcgaaattcgcggacgcgccggggctgagcgcggaaacg
aagcggcgactgctgatgctgcggaccgcactgacattgcctgctccgacgacgtcgggg
gcggcggatgagttgaacagcctcgcgaccagcctgcaatcggcttatggcaagggaaaa
gggactttacgcggccagcccatcaacggcagcgatatcgaagccgccatgggcaccagt
cgcaaccccgatgaactcaaggaaatgtgggtgagttggcacgacaatgtcggcgcgccg
atgcggcaggattatacggagctggtttctatcgccaatgccggagcgaaagaactgggc
tttgccgatacgggagctatgtggcgatccaaatatgacatgccggccgatgatttcgcc
aagctgaccgacaggatatgggcggaagtgaagccgctctataacgatctgcattgctac
acccgcaccaagctcaacgagaaatatggcaatccggtgcagcccgacaacgggccgatc
cgcgccgacctattgggcaatatgtgggcgcaggaatggggcaatatctatgacattgtt
gcgcccaagggcattggcgaccttggctatgacattggcgacttgctgacggccagggga
tatgatccgataaagatggtgaaggcgggcgaaggcttttacagttcgctgggattcaag
ccgctgccgcagacattctgggaccgctcgcagatcgtaaagccgcgggaccgcgacgtg
gtgtgtcatgcttcggcatgggatctcgataataaggacgacatccggatcaagatgtgc
acaaaggtcaacagcgacgatttcgtgactatccatcatgaactgggccataactattat
cagcgcgcctatcagaaccatccttacctgtatctggatggcgccaatgacggcttccat
gaggcgattggggatttcgtcgcgctgtcgatcacgccggattatctggtgaagatcggg
ctgctcgatgcaacaaaggtgccgggcccggacaaggatatggggctgctgctgcggcag
gcgatggacaaggtagccttcctgccctttggcctgctgatcgacaagtggcgctggggc
gtgttcgacgggaccatcgcgccggatcattatgaacaggcgtggaacgatctgcgccgc
cagtatcagggcatcgtcccgccggtgtcccgcgatgagacggcgttcgatcccggcgcc
aaatttcatatccccggcaatacgccctatacacggtatttcctggcgcgcgtccttcag
ttccaattctatgagacagcgtgcaggcaagccggatggaaagggccgctccatcgctgt
tctttttatggaaacaaggcagtagggcagaaacttaacactatgctcgaaatgggggct
tccaagccatggccggatgcgttgcaggctttcaccggtcagcgggatatatcaggcaaa
gcgttgctcgcatattttgcgcctttgcagaaatggttgcaggaacaaaataaaggaaag
tcttgcggctggtaa

DBGET integrated database retrieval system