KEGG   Sphingobium baderi: ATN00_17140Help
Entry
ATN00_17140       CDS       T04194                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sbd  Sphingobium baderi
Pathway
sbd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sbd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ATN00_17140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbd02000]
    ATN00_17140
Enzymes [BR:sbd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ATN00_17140
Transporters [BR:sbd02000]
 Other Transporters
  Pores ion channels [TC:1]
   ATN00_17140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C DSX_dimer
Motif
Other DBs
NCBI-ProteinID: ALR21766
UniProt: A0A0S3F271
LinkDB All DBs
Position
3520446..3521075
Genome map
AA seq 209 aa AA seqDB search
MAEITFYTNPMSRGQIVRWMLEEVGEPYDLVPLDYGTGMKASDYLAINPMGKVPAIVHAG
KTITEAAAICAYLADAFPAAHLAPPIDRRADYYRWLFFAAGPVEAAVTNKALGFIIPEGR
ERMAGYGTFDHTIDALESAVSGPGWICSDQFTAADVYVGAQIDWGLQFGTIPNRPSFDAY
AVRLRDRPGYQRQRELDNALIAKMQRNSQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcagagatcaccttctacacaaaccccatgtcacgcggccagatcgtgcgatggatg
ctggaggaggttggcgaaccatatgacctcgtcccactcgactatggcaccggcatgaag
gcatccgactacctcgccatcaatcccatgggcaaagttcccgctatcgtccatgccgga
aaaacgatcaccgaagccgcagccatctgcgcctatctggctgatgccttcccggcggcc
catcttgctccgcctattgaccgccgcgccgattattaccgctggctctttttcgcggct
ggccccgtggaagcggcggtgaccaacaaggctctcggcttcatcatcccggaaggccgg
gaacgaatggcgggatatggaacgttcgaccacaccatagatgcattggaaagcgccgtt
tcaggccccggctggatttgcagcgatcagtttaccgcagccgatgtctatgtcggcgcg
cagattgattggggacttcaattcggcaccattcccaaccgcccatcctttgatgcctat
gccgtccgccttcgcgaccgtcccggctatcagcggcagagggaattggacaatgctctg
atcgccaagatgcagcgaaacagccaataa

DBGET integrated database retrieval system