KEGG   Sphingobium baderi: ATN00_18765
Entry
ATN00_18765       CDS       T04194                                 

Name
(GenBank) hypothetical protein
Organism
sbd  Sphingobium baderi
SSDB
Motif
Pfam: HTH_18 HTH_AraC Cupin_6 Cupin_3 HTH_19
Other DBs
NCBI-ProteinID: ALR22040
UniProt: A0A0S3F3C7
LinkDB
Position
3847698..3848720
AA seq 340 aa
MLPVRVTLYHTPAAHLPAKAGENNEKRALVGLESVDTQTWSRFEEDRPQLNAAQSLIRDH
TVLSDLLEGIRVEQTSYRLLRNGDGVLDGRRAPDELVGFYFLTGEVEFTSPGAGPIHARK
GDYLLLCHGTRYCIRPTSENGKCSIGHLVFSLDGLRARLLFRILPKVLFISGLSQEEMQW
QMQLEHLITHHPRAFSTASPAINHRLIEASIISNIQTFFYREGSQAYQIDSPDLVRVYAS
VKALHECPERAWTIAALADLSSMSKTLFVAKFKDATGMPPARYLSMLRLDRVKELLRARS
LSLTQIAHRTGYSTDMALIHAFKRQFGITPGQFRSAHQWS
NT seq 1023 nt   +upstreamnt  +downstreamnt
ttgctgcccgtccgcgttacactctaccatacccccgccgcgcacctgcccgcaaaggcc
ggggagaacaatgaaaagcgggcactggtgggattggaaagcgtggacacacagacctgg
tcgaggttcgaggaggaccgtccgcaactcaacgcagcgcagtcgttgatccgcgatcac
acggtcctgtccgatctgctggagggcattcgcgtcgagcagacgtcctaccggctgctc
agaaacggtgacggagtattggacggccgcagggcgccggacgagctcgtcggtttctat
ttcctcaccggtgaagtcgagttcacctctcccggcgctggacccatccatgcgcgcaag
ggcgattatctgctgctgtgccatggcacgcgctactgtataaggccgacatccgagaac
gggaaatgctcaattggccacctcgttttcagtctcgacgggctgcgcgcccggctgctc
ttccggatcctgccgaaggtcctgttcatcagcggcctctcgcaggaggagatgcagtgg
caaatgcagttggaacatctcatcacgcaccaccccagggcattttccactgcctcgccg
gcgatcaaccaccggctgatcgaagcgtccatcatcagcaacatacagacgtttttctat
cgcgaaggatcacaggcctaccagatcgacagccccgatctcgtccgcgtttacgccagc
gttaaggcattgcacgaatgtccggaacgagcctggaccatcgccgccctcgccgatcta
tcgagcatgtcgaagacgctgttcgtcgctaagttcaaggatgccactggcatgccgccc
gcccggtatctcagcatgctgcggctggaccgggtaaaggagttactgcgtgcgcgctcg
ctctcgctcactcagattgctcatcgcaccggatacagcaccgacatggccctgatccac
gcattcaagcggcagtttgggataacgccgggacagttccgcagcgcccaccaatggtcc
tga

DBGET integrated database retrieval system