KEGG   Silvanigrellales bacterium RF1110005: JCM31447_07960Help
Entry
JCM31447_07960    CDS       T05949                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sbf  Silvanigrellales bacterium RF1110005
Pathway
sbf00061  Fatty acid biosynthesis
sbf00071  Fatty acid degradation
sbf01100  Metabolic pathways
sbf01212  Fatty acid metabolism
sbf02024  Quorum sensing
Module
sbf_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sbf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JCM31447_07960
   00071 Fatty acid degradation
    JCM31447_07960
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JCM31447_07960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbf01004]
    JCM31447_07960
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbf04147]
    JCM31447_07960
Enzymes [BR:sbf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     JCM31447_07960
Lipid biosynthesis proteins [BR:sbf01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   JCM31447_07960
Exosome [BR:sbf04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   JCM31447_07960
  Exosomal proteins of breast cancer cells
   JCM31447_07960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: BBH52355
UniProt: A0A4P2VSR9
LinkDB All DBs
Position
899975..901717
Genome map
AA seq 580 aa AA seqDB search
MSGSNFECVDRPWQNHYGQGTNCELENFEYNNLAEMVAKNSDRWKDRTAYHMILPNGMDK
MITFAETEALSNYFAVYLREELKLKVGDRVAIQLPNCLAYPIVVFGCYKAGLAIVNANPL
YTAHEMQHQFLDSGAKVLVIIDMFSDKLKQVIPNTKIEKVVLVSVADLFSLHKKILIKSV
LKYVRKQIPTCEVHSVPFEETLKTGKRILNENNIDVINYWITVTLDDICALQYTGGTTGI
SKGAMLTHRNIIANMYQIIEMGKSKITNGQEVLLTVLPLYHIFAFTVNLITFFKVGGISV
LIPNPRPLTNIKKAFEKADITWISGVNTLFNGLLNEKWFSENPPIHLKASIAGGAALHKA
VSERWLKVTNTSVVEGYGLTETSPVVCFNPINGVVKSDTVGVPVPSTDILLINEEGKSVP
IGEEGEIAVKGPQVMLGYWQRPEETSKVLKDGWMLTGDIAVMDQDGYIKIVDRKKDMILV
SGFNVYPNEVEDCIAKLPGVGEVAVIGIPNERTSEAVKAFIVKKDSDLSEKQVIEHCKKF
ITAYKVPKFVEFRIELPKSPIGKILRKNLRAEELSKPHNE
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtagtaattttgagtgtgtagatcgtccttggcaaaatcattatgggcaaggg
acaaattgtgaattagaaaattttgaatataataatttagcagaaatggttgcaaaaaac
tcagatcgttggaaagacagaactgcttatcatatgattctccccaatggcatggataaa
atgataacttttgcagagacagaagcactttcaaattattttgcagtttatttaagagag
gaattgaaattaaaagtaggagatagagttgctatccaattgccaaattgccttgcctat
ccaattgttgtgtttgggtgttataaagctggtctagcaatagtaaatgcaaatcctctt
tacacagcgcatgaaatgcagcatcagtttttagacagtggggcaaaagttcttgtcata
attgatatgttttcagataaactcaaacaagttattccaaatacaaaaattgagaaagtt
gtattagtgagtgttgcagatcttttctcactgcataaaaagatattgataaaatcagta
ttaaaatatgttagaaaacaaattcctacctgtgaagttcattctgttccttttgaagaa
actcttaaaactggcaagagaattttaaatgaaaataatatagatgttattaattattgg
ataactgttactttagatgatatttgcgctttgcagtatacgggaggaacaactgggatc
agtaaaggggctatgttaactcatagaaatattattgcaaatatgtatcagataatagaa
atggggaaatcaaaaataacaaatggtcaagaagtattactgacagttctacctctctat
catatatttgcttttactgttaatttaatcacattttttaaagtgggtggtatcagtgtt
ttaattcccaatccacgtccactcacaaatataaaaaaagcattcgaaaaagcagatatc
acttggatttctggtgtgaatactctttttaatggtctattaaatgaaaaatggttctct
gaaaaccctcctattcatttaaaagcatctattgctggtggggcggcattgcacaaagca
gtttcggaaagatggttaaaagtaacaaatacttcagttgtcgaaggttatggcttaacc
gaaacatcacccgttgtctgttttaatcctatcaatggagtggttaaatcagatacagta
ggtgtgcctgtaccgagtacagatattcttttaatcaatgaagaaggtaaatctgtgccg
atcggtgaagagggagaaattgctgtcaaaggtcctcaggtcatgctcggatattggcaa
cggcctgaagaaacatcgaaagtattgaaagatggctggatgttgactggcgatattgct
gttatggatcaagatgggtatattaaaattgttgatcgtaaaaaagatatgattctcgta
agtggttttaacgtatatccaaatgaagtagaagactgtatcgcaaaattaccgggtgtg
ggtgaagtcgctgttatcggtataccaaatgaacgcacgagtgaagccgtaaaagctttt
atcgtaaaaaaagattcagatttatctgaaaaacaagttattgagcactgcaaaaagttt
atcacagcttataaagttcctaaatttgttgaatttagaatagagctgcccaaatctcct
ataggtaagatattacgtaagaatctgcgcgcggaagaattgagtaaacctcataatgag
tga

DBGET integrated database retrieval system