KEGG   Silvanigrellales bacterium RF1110005: JCM31447_15790Help
Entry
JCM31447_15790    CDS       T05949                                 

Definition
(GenBank) hypothetical protein
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
sbf  Silvanigrellales bacterium RF1110005
Pathway
sbf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sbf01100  Metabolic pathways
sbf01110  Biosynthesis of secondary metabolites
sbf01130  Biosynthesis of antibiotics
sbf01230  Biosynthesis of amino acids
Module
sbf_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sbf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    JCM31447_15790
Enzymes [BR:sbf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     JCM31447_15790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH ABC_sub_bind AIRC YuiB
Motif
Other DBs
NCBI-ProteinID: BBH53136
UniProt: A0A4P2VJ36
LinkDB All DBs
Position
complement(1827750..1829000)
Genome map
AA seq 416 aa AA seqDB search
MIDILLNKEKELKVILNDFFRKKYQRNSIPEFSIDYDTEAFQVACQIYKRGFINIANVMS
EVYQDVPIQFLDNLQFEQILQKKNAKQIFYIVDMNICKYYEKFIPSEKIFLYKASELNKN
IDSVITILKSLPKECNEIIAIGGGNTLDVSGFVAAIAKIPIIYCATTLLATVDAATGGKT
GVNCPLYGKNQIGLFYKAKEFYCVPEFFHTLPHSEIISGLCEALKHSWLYGSFAEEKKYF
EEILISNCSIENLKIFLIKNIEYKTNIITQDPFERKGIRLALNFGHTLAHLIEALAEDKK
IERMPHGISVAHGIYFLIKNRIIECPCISFLNYLEKIIILFPIVKISTIDSSNIERYIRQ
DKKNINTFQCALSLPSYGQFSMSKNNVAFIDLLKNYTIDYLVVLTSQYLNSFNIHS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgattgatattcttttaaacaaagagaaagaattaaaagttattttaaatgatttcttt
agaaaaaaatatcagcgcaattcaattcccgaattttctattgattatgacactgaagca
tttcaagtagcctgtcaaatttataaaagaggttttataaatattgcgaatgtaatgtct
gaagtttaccaagatgtaccaatacaatttttagataatttgcagtttgagcagatccta
caaaagaagaatgccaaacaaattttttatatcgtcgatatgaatatatgcaaatattat
gaaaaatttattccttctgaaaaaatttttttatataaagcgagtgaattaaataaaaat
atcgatagtgtcattacaattttaaaatccttacccaaggaatgcaatgaaattattgcc
attggcggaggaaatactcttgatgtgtctggctttgttgctgcaatagctaagattcca
attatatactgtgcaaccactcttttagctacagtcgatgcagcgactggaggtaaaacc
ggcgtaaactgtccattgtatggaaagaatcaaataggtcttttttataaggcaaaagag
ttttattgcgtgcctgaattctttcacactcttccccattcagaaataatttctggattg
tgtgaagcattaaagcattcttggttgtatggttcatttgcggaagaaaaaaaatatttt
gaagagatattaatatctaattgttctatcgaaaatttaaagatttttttaataaaaaat
atagaatataagactaatattattacccaagatcctttcgaaagaaagggtattcgcttg
gctttaaactttggtcataccttggcacatttgattgaagctcttgcagaagataaaaaa
atagaaagaatgccacatgggatttccgttgctcatgggatatattttttaataaaaaat
cgtataattgaatgtccatgtataagtttcttgaactatttagagaaaataataatttta
tttcctattgtaaaaatttccactatcgattcaagtaatattgagcgttatataagacag
gacaaaaaaaatataaatacttttcaatgtgcattaagtttaccatcttatggtcagttt
tctatgagtaaaaataatgtcgcttttatagatctattaaaaaactatacaatagattat
ttggtagtattaacttcacaatacttaaatagttttaacatacattcttaa

DBGET integrated database retrieval system