KEGG   Salmonella bongori NCTC 12419: SBG_0336Help
Entry
SBG_0336          CDS       T01579                                 

Gene name
ddlA
Definition
(GenBank) D-alanine:D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00473  D-Alanine metabolism
sbg00550  Peptidoglycan biosynthesis
sbg01100  Metabolic pathways
sbg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SBG_0336 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SBG_0336 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SBG_0336 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbg01011]
    SBG_0336 (ddlA)
Enzymes [BR:sbg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SBG_0336 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:sbg01011]
 Precursor biosynthesis
  Amino acid ligase
   SBG_0336 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: CCC29433
UniProt: A0A0K0H7T3
LinkDB All DBs
Position
complement(393411..394505)
Genome map
AA seq 364 aa AA seqDB search
MAKLRIGIVFGGKSAEHEVSLQSAKNIVEAIDKTRFDVVLLGIDKAGQWHVNDAENYLQN
ADDPAHIALRPSEMSLAQVPGKHEHQLINAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRHAFSFAEVESRLGL
PLFVKPANQGSSVGVSKVANEAQYHQAVALAFEFDHKVVVEQGIAGREIECAVLGNDRPQ
ASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQIPSEVNDKIRAIAIQAYQTLGCAGMAR
VDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLSYTDLISRLIELALERHTADNAL
KRTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattgcggataggaatagtatttggtggtaaatcagcagaacatgaagtgtct
ttgcaatcggcgaaaaatatcgttgaggcaatagataaaactcgctttgacgtagtgcta
ttagggatagataaagcgggacagtggcatgttaacgatgcggaaaattatttacagaat
gccgacgatccggcacatatcgcgctacgcccttcggaaatgagtcttgcccaggtgcca
ggcaaacatgagcaccaattgatcaacgcccagaacggtcagccgctaccgacggtagat
gtgattttccccatcgtccacggtacgttaggtgaagacggctcattgcaaggcatgcta
cgcgtcgcaaacttaccgtttgtcggttcagacgtcctgagttccgcggcctgcatggat
aaagacgttgccaaacgactgctgcgcgatgcaggtctgaatatcgccccgtttattacc
ctcacccgaacgaatcgtcacgcgtttagttttgccgaggttgaatcccgtctgggcctg
ccgctgttcgttaaacctgccaaccagggatcttcggtcggtgtcagtaaagtcgccaat
gaagcgcagtaccatcaggcggtcgcgctggccttcgaattcgatcataaagttgtagtc
gaacaagggatcgctggccgcgagatcgaatgcgccgtattaggtaacgatcgcccgcag
gccagtacctgtggtgaaatcgtgctgaatagcgaattttacgcctacgatactaaatac
attgatgataatggcgctcaggttgtggtaccggcgcaaataccttccgaggtgaacgac
aagatccgcgcgatcgcgattcaggcttatcagacgctgggctgcgcaggtatggcgcgt
gtcgatgtctttttaacggcagataatgaggtggtgatcaacgagatcaatacgctgcct
ggttttaccaatatcagcatgtatccaaaactctggcaggcgagcggactgagttatact
gatttgatcagccgcctgattgaactggcgctggaacgccatacggcggataacgcctta
aaaaggacgatgtaa

DBGET integrated database retrieval system