KEGG   Salmonella bongori NCTC 12419: SBG_0518Help
Entry
SBG_0518          CDS       T01579                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase F52A protein (subunit F)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sbg  Salmonella bongori NCTC 12419
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SBG_0518 (ahpF)
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SBG_0518 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 Thi4 Glutaredoxin NAD_binding_8 K_oxygenase AlaDh_PNT_C DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: CCC29611
UniProt: A0A0K0H893
LinkDB All DBs
Position
585916..587481
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKENNSLPV
RKPSFLITNPGSEQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQELLAQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKE
FGQGRMTLSEIIAKVDTGAEKRAAEALNKREAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLIPAASEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRVSGDTHQVALAGIFVQIGLLPNTQWLEGALERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRSKVA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactaacatgaaaacccagctcaaggcctaccttgagaaactgaccaaacct
gttgagctgattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgctg
gcggaaatcgccgaactttcaccgaaagtgacctttaaagaaaataacagcctgcccgtg
cgcaagccctcttttctgatcaccaatccaggctcggagcaggggccgcgctttgcgggc
tcgccgctgggccatgaatttacctcgctggtgctggcgctgctgtggacgggggggcat
ccgtctaaagaggcgcaggaactgctggcacagatccgcgatattgacggtgattttgag
ttcgaaacatattattccctttcctgccacaactgcccggacgtggtacaggcgctgaac
ctgatggcggtgttgaatccacggattaaacatacggcgattgacggcggcaccttccag
aatgaaatcaccgagcgtaacgtaatgggggttccggcggtatttgtgaacggtaaagag
ttcggccagggacgtatgactctgagcgaaattattgccaaagtggataccggggcagaa
aaacgagcggcggaagcgttaaacaaacgcgaggcgtatgatgtactgattgtcggttcc
ggtccggcaggggcggcggcggcggtttactcggcgcgtaaggggattcgtaccggtttg
atgggcgaacgttttggtggccaggtgctggatactgttgatatcgaaaactatatttca
gtgccaaaaaccgaaggccagaaactggcgggcgcgctgaaagcgcatgtcagcgattat
gacgttgacgtcattgatagtcagagcgcaagtaaactgattccggcagcgtcagaaggc
ggattgcatcagattgaaaccgcgtccggcgcagtattgaaagcgcgcagtgttatcatc
gccactggcgccaaatggcgtaatatgaatgtgcccggtgaagatcagtatcgcaccaaa
ggcgtgacttattgcccgcattgtgacggtccactgtttaaaggcaagcgtgttgccgtt
attggaggcggtaactctggcgttgaagcggctatcgatctcgcagggattgtagaacac
gttaccctgctggagtttgcgccggaaatgaaagccgaccaggtattgcaggataaagtc
cgtagtctgaaaaacgtcgatattattctgaatgcgcaaaccaccgaagtgaaaggtgat
ggtagcaaggttacgggtctggagtatcgcgatcgcgtcagtggtgacacgcatcaggtt
gcactggcggggatcttcgtgcagatcggcctgctgccgaatacccagtggctggaaggc
gcgctggaacgtaaccggatgggcgaaattatcattgacgccaaatgtgaaaccagcgtt
aagggggtctttgcggcgggtgactgtaccactgtcccttacaagcagattattatcgcc
acaggcgagggggcaaaagcctcgcttagtgcctttgattatctgattcgcagcaaagtc
gcctaa

DBGET integrated database retrieval system