KEGG   Salmonella bongori NCTC 12419: SBG_0863
Entry
SBG_0863          CDS       T01579                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
sbg  Salmonella bongori NCTC 12419
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sbg03009]
    SBG_0863
Enzymes [BR:sbg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     SBG_0863
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     SBG_0863
Ribosome biogenesis [BR:sbg03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SBG_0863
SSDB
Motif
Pfam: UPF0020 THUMP Methyltrans_SAM Cons_hypoth95 Methyltransf_31 Methyltransf_25 MTS Methyltransf_11 Methyltransf_15 Methyltransf_24 N6_Mtase
Other DBs
NCBI-ProteinID: CCC29958
UniProt: A0A0K0H948
LinkDB
Position
981587..983695
AA seq 702 aa
MNSLFASTARGLEELLKTELEKLGAVGCQVVQGGVHFQGDTRLIYQSLMWSRLASRIILP
MGECKVYSDLDLYLGVQAINWTEIFNPGATFAVHFSGLNDTIRNSQYGAMKVKDAIVDAF
TRKNLPRPNVDRESPDLRINVWLNKETASIALDLSGDGLHLRGYRDRAGLAPIKETLAAA
IVMRSGWQPGTPLLDPMCGSGTLLIEAAMWATDRAPGLHRGHWGFSGWAQHDGTIWQEVK
AEAQTRARKGLAEYSSHFYGSDSDARVIERARSNARRAGISELITFEVKDVAQLSNPLSK
GPYGTVISNPPYGERLDSEPALIALHSLLGRTMKNQFGGWNLSLFSASPDLLGSLQLRAD
KQFKAKNGPLDCVQKNYHIAETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRL
YDADLPEYNVAVDRYGDWAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLK
TRERQKGKNQYQKMSEKGEFLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK
DFLNLFSYTGSASVHAGLGGARSTTTVDMSRTYLEWAERNLRLNGLSGRAHRLIQADCLG
WLREANEQFDLIFIDPPTFSNSKRMEESFDVQRDHLALMKDLKRLLRKDGTIMFSNNKRG
FRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCWLIRAA
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgaattctctgtttgccagtacggcccgcgggctggaagagctgttaaaaactgaactg
gaaaaactgggcgccgtagggtgtcaggttgttcagggtggggtccattttcagggcgac
acgcggcttatttaccagagtctgatgtggagccgtctggcctcgcgtattatcctgccg
atgggggagtgtaaagtctacagcgatctggacctttacctcggcgttcaggcgataaac
tggacagagatttttaatcctggcgcgacctttgcggtgcattttagcggtctgaacgac
accatccgtaatagccagtatggcgcgatgaaagtcaaagacgcgattgtcgatgcgttt
acgcggaaaaatcttccgcgtccaaatgtggatcgcgaatcgccggatctccgtattaat
gtctggctgaataaagagacggccagcattgcgctggatctcagcggtgatggtctgcac
ctgcgtggctaccgcgatcgtgctggccttgcgccaattaaagaaacgttggcggcggcg
attgtgatgcgttccggctggcagccgggcacgccgttgctcgatccgatgtgtgggtcc
gggacgttattgattgaagccgcgatgtgggcgaccgatcgcgcgccgggcctgcaccgt
ggccactggggatttagcggctgggcacagcatgacgggactatctggcaggaagtgaaa
gccgaagcacagacccgggcgcgtaaggggctggcagaatattcgtcgcatttctatggt
tctgacagcgatgcgcgcgtcattgagcgggcacgcagcaacgcccgtcgcgccggtatc
agcgagctaatcacctttgaagtgaaagatgtggcgcaactgagtaatccgttgtcgaaa
ggcccgtatggtacggttatcagtaacccgccctatggcgaacgtctggacagcgaaccg
gcgctgattgcgctgcatagcctgctgggtcggacgatgaaaaaccaatttggcggttgg
aatttgtcgctgttcagcgcctcgcctgatttgctgggcagtctgcaacttcgtgccgac
aaacagtttaaagccaagaatggtccgctggactgcgtgcagaaaaactatcatattgcg
gaaaccactgcggacagtaaaccggcaacggtggcggaagattatgctaatcgcctgcgt
aagaatcttaaaaagctggaaaaatgggcgcgtcaggaaggcattgagtgctatcgctta
tatgatgccgacctgccggaatataacgtggcggtagaccgttacggcgactgggcggtg
attcaggaatatgcgccgccgaaaacggtggatgcgcaaaaagcgcggcaacgtctgttc
gatattattgcggcaaccttgtcagtgctcggtattccgccgaataaactggtattaaaa
acccgggaacggcaaaaaggaaaaaaccagtatcagaaaatgagcgagaagggcgagttc
cttgaggtcagcgaatataatgcgcgcttatgggtaaatctgacggattatctcgacacc
ggtctgttcctcgatcaccgtattgctcgcagaatgctgggagaaatgagcaaaggcaaa
gatttcctgaatctcttttcttataccggcagcgccagcgtacatgcagggctgggcggc
gcacgcagtaccacaacggtggatatgtcccgtacctatctggaatgggccgaacgtaat
ttgcgcttgaatggactgagtggccgcgcgcatcgcctgattcaggccgactgcctgggc
tggctgcgcgaagcaaacgaacagttcgatctgatctttatcgatccaccgacgttttct
aactcaaaacgtatggaagagtcgtttgatgtccagcgcgatcatttggcattaatgaag
gacttaaaacgcctgctgcgtaaagacggcaccattatgttctctaataataagcgcggg
ttccgtatggatctggaagggttggctgaattggggcttaccgcacaagaaattacgcaa
aaaacgctctccccggattttgcccgtaaccgtcagatccataattgttggctcatccgc
gccgcctga

DBGET integrated database retrieval system