KEGG   Salmonella bongori NCTC 12419: SBG_1035Help
Entry
SBG_1035          CDS       T01579                                 

Gene name
fabF
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00061  Fatty acid biosynthesis
sbg00780  Biotin metabolism
sbg01100  Metabolic pathways
sbg01212  Fatty acid metabolism
Module
sbg_M00083  Fatty acid biosynthesis, elongation
sbg_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SBG_1035 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SBG_1035 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbg01004]
    SBG_1035 (fabF)
Enzymes [BR:sbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     SBG_1035 (fabF)
Lipid biosynthesis proteins [BR:sbg01004]
 Fatty acid synthase
  Component type
   SBG_1035 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: CCC30131
UniProt: A0A0K0H963
LinkDB All DBs
Position
1143394..1144599
Genome map
AA seq 401 aa AA seqDB search
MLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCDDIISRKEQRKMD
AFIQYGIVAGVQAMQDSGLEVTEENATRIGAAIGSGIGGLGLIEENHSSLVKGGPRKISP
FFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADAMVAGGAE
KASTPLGVGGFGAARALSTRNDDPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKARGA
KIYAEVVGFGMSSDAYHMTSPPEDGAGAALAMVNALRDAAIEPGQIGYVNAHGTSTPAGD
KAEAQAVKSVFGDAASRVMVSSTKSMTGHLLGAAGAVESIFSILALRDRAIPPTINLDNP
DEGCDLDFVPHEARQVSDLEYALCNSFGFGGTNGSLIFKKI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctcctgtcggcaataccgtagagtctacctggaaagctctccttgccggtcag
agtggcatcagcctgatcgaccatttcgatactagcgcctatgcaacgaaatttgctggc
ttagtaaaggattttaactgtgatgacattatctcgcgtaaagaacagcgcaagatggat
gccttcattcaatatggaattgtcgctggcgttcaggccatgcaggattctggccttgaa
gtgacggaagagaacgcaacccgtattggtgccgctattggctccggtatcggtggtctc
ggtctgatcgaagaaaaccacagttcgctggtaaaaggcggaccgcgtaaaatcagcccg
ttcttcgtcccgtcgacgattgttaacatggtggcaggtcatctgactatcatgtatggc
ctgcgtgggccaagcatctctattgctactgcctgtacttcgggcgtgcataacatcggt
catgccgcgcgtattattgcctatggcgatgcggacgcgatggtggcgggtggcgctgaa
aaagccagtacgccgctgggcgtaggcggttttggcgcagcgcgcgcgctgtctacccgc
aacgatgacccgcaggcggccagccgtccgtgggataaagagcgcgatggttttgtgttg
ggcgacggtgcaggtatgctggtactcgaagagtacgaacatgcaaaagcgcgcggcgcc
aaaatttacgctgaagttgtcggatttgggatgagcagcgatgcttaccatatgacgtca
ccgccggaagatggcgcaggtgcggcgctggcgatggttaacgcattgcgtgatgctgct
atcgagccgggtcagattggctacgtcaatgcgcacggcacgtctacgcctgctggcgac
aaagctgaggcacaggccgttaagtctgtctttggcgacgctgcaagccgtgtgatggtg
agttcaaccaagtcgatgacgggtcatctattgggtgctgcaggcgcagtagagtcgatt
ttctctattctggcgctgcgcgatcgtgccattccgccgaccatcaacctggataacccg
gatgaaggttgtgatctggactttgtgccgcacgaagcgcgccaggtcagcgatctggag
tatgctctgtgtaactcctttggctttggcggaactaacggttccttgatctttaaaaag
atctaa

DBGET integrated database retrieval system