KEGG   Salmonella bongori NCTC 12419: SBG_1140Help
Entry
SBG_1140          CDS       T01579                                 

Definition
(GenBank) putative zinc-type alcohol dehydrogenase
Organism
sbg  Salmonella bongori NCTC 12419
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ThiF Cupin_2 NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCC30230
UniProt: A0A0K0HA44
LinkDB All DBs
Position
1252168..1253211
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILKTPGTMTIMAADIPVPKENEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVIAVGNRVSKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIVILGAGCI
GLMTLQACKCLGATNIAVVDVLEKRLAMAERLGATTVINGAKEDAVARCQQFTDDMGADI
VFETAGSAVTTQQAPYLVMRGGKIMIVGTVAGDSAINFLKINREVSIQTVFRYANRYPVT
IDAISSGRFDVKSMVTHIYDYKDVQRAFEESVNNKRDIIKGVIKVCD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatattaaaaacaccgggcaccatgacaattatggcggctgat
attccagtaccaaaagaaaacgaagtattgatcaaagtggaatatgtcggtatttgcggt
tcagatgttcacggttttgaatccgggccattcattcctccgaaggatccaaatcaggag
attggtctcggtcatgagtgtgccggaacagtcattgcggtcggcaatcgggtaagcaaa
tttaagccaggcgatcgggttaatatcgagccgggcgtgccgtgcggccactgccgctat
tgtctggaaggaaaatacaatatttgtccggatgttgattttatggcgacgcagccgaat
tatcgcggggccttaactcactatctgtgccatccggaaagttttacgtacaagcttccg
gacaatatggacactatggaaggtgcactggtggaacccgctgctgttggaatgcacgcg
gcaatgctggcggatgttaaaccgggtaagaaaatcgtcattctcggcgcgggctgcatt
ggtttaatgaccctgcaagcgtgtaagtgtctgggtgcgaccaatatcgcggtagtggat
gtgctggaaaaacggctggcaatggctgaacgactgggagcgacaaccgttatcaatggg
gcgaaagaagatgctgtcgcgcgctgccagcagttcaccgatgatatgggcgccgatata
gtgtttgaaaccgccggttccgccgtcacaactcagcaagcgccgtatctggtcatgcgt
ggcgggaagatcatgattgtcggcactgtcgcaggagattcagcgattaatttcctcaaa
attaaccgtgaagtctccatccagacggtattccgctatgccaaccgctatccggttact
attgatgccatctcctccgggcgtttcgatgtgaaatcaatggtgacgcatatttacgat
tacaaagacgtacaacgtgcatttgaagagtcggtcaataacaaacgcgacattattaaa
ggcgttattaaagtttgcgattaa

DBGET integrated database retrieval system