KEGG   Salmonella bongori NCTC 12419: SBG_1140
Entry
SBG_1140          CDS       T01579                                 

Definition
(GenBank) putative zinc-type alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00040  Pentose and glucuronate interconversions
sbg00051  Fructose and mannose metabolism
sbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SBG_1140
   00051 Fructose and mannose metabolism
    SBG_1140
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SBG_1140
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ThiF ADH_N_2 Cupin_2 NAD_binding_3
Other DBs
NCBI-ProteinID: CCC30230
UniProt: A0A0K0HA44
LinkDB
Position
1252168..1253211
AA seq 347 aa
MKNSKAILKTPGTMTIMAADIPVPKENEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVIAVGNRVSKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIVILGAGCI
GLMTLQACKCLGATNIAVVDVLEKRLAMAERLGATTVINGAKEDAVARCQQFTDDMGADI
VFETAGSAVTTQQAPYLVMRGGKIMIVGTVAGDSAINFLKINREVSIQTVFRYANRYPVT
IDAISSGRFDVKSMVTHIYDYKDVQRAFEESVNNKRDIIKGVIKVCD
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatattaaaaacaccgggcaccatgacaattatggcggctgat
attccagtaccaaaagaaaacgaagtattgatcaaagtggaatatgtcggtatttgcggt
tcagatgttcacggttttgaatccgggccattcattcctccgaaggatccaaatcaggag
attggtctcggtcatgagtgtgccggaacagtcattgcggtcggcaatcgggtaagcaaa
tttaagccaggcgatcgggttaatatcgagccgggcgtgccgtgcggccactgccgctat
tgtctggaaggaaaatacaatatttgtccggatgttgattttatggcgacgcagccgaat
tatcgcggggccttaactcactatctgtgccatccggaaagttttacgtacaagcttccg
gacaatatggacactatggaaggtgcactggtggaacccgctgctgttggaatgcacgcg
gcaatgctggcggatgttaaaccgggtaagaaaatcgtcattctcggcgcgggctgcatt
ggtttaatgaccctgcaagcgtgtaagtgtctgggtgcgaccaatatcgcggtagtggat
gtgctggaaaaacggctggcaatggctgaacgactgggagcgacaaccgttatcaatggg
gcgaaagaagatgctgtcgcgcgctgccagcagttcaccgatgatatgggcgccgatata
gtgtttgaaaccgccggttccgccgtcacaactcagcaagcgccgtatctggtcatgcgt
ggcgggaagatcatgattgtcggcactgtcgcaggagattcagcgattaatttcctcaaa
attaaccgtgaagtctccatccagacggtattccgctatgccaaccgctatccggttact
attgatgccatctcctccgggcgtttcgatgtgaaatcaatggtgacgcatatttacgat
tacaaagacgtacaacgtgcatttgaagagtcggtcaataacaaacgcgacattattaaa
ggcgttattaaagtttgcgattaa

DBGET integrated database retrieval system