KEGG   Salmonella bongori NCTC 12419: SBG_2078Help
Entry
SBG_2078          CDS       T01579                                 

Gene name
glpA
Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00564  Glycerophospholipid metabolism
sbg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SBG_2078 (glpA)
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SBG_2078 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Pyr_redox_2 Thi4 3HCDH_N HI0933_like NAD_binding_8 GIDA Pyr_redox_3 Lycopene_cycl SO_alpha_A3 FtsA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: CCC31139
UniProt: A0A0K0HBY6
LinkDB All DBs
Position
2270572..2272200
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQASDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDDLTFQATFIRACETAGIRAEA
IDPQQARLIEPSVNPALIGAVKVPDGTVDPFRLTAANMLDAREHSAIVLTAHEVTGLIRE
GATICGVHVRNSLTGETQTFHAPVVVNAAGIWGQRIAEYADLNIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSTHIDYNEIDSNRVTAEEVDILLREGEKLAP
IMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGLEGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCTTADTPLPGSKESTERTLKRIISLPAPLRGSAVYRHGDRTP
EWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTAAQSITQLSEFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEHQD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgtgactcgcaagcaagtgacgtgattatcattggcggtggagcaacaggc
gcagggatcgcccgtgactgcgcgttacgcggtttacgcgtcatcctggtggaacggcat
gatattgcgaccggcgcgaccgggcgtaatcacgggttgctgcacagtggcgctcgttat
gcagttactgacgcggaatccgcccgcgagtgcattagcgaaaatcagatcctgaaacga
atcgcccgtcattgcgtcgaaccgacggatggtctgtttatcacattaccagaagacgat
cttacgtttcaggctacctttattcgcgcctgtgaaacggcaggcattcgcgctgaagct
atcgatccgcaacaggctcgccttattgagccttccgtcaaccctgcgcttatcggcgcg
gtaaaagtgccggacggcacggtggaccctttccgcctcaccgccgccaatatgctggac
gccagagaacatagcgccatcgtgttgacggcgcatgaagtgaccggacttattcgcgaa
ggcgcaacaatctgtggcgttcatgtgcgcaactctctcactggcgaaacccagacgttc
catgcgccagtggtggttaatgcggctggtatctggggtcaacgaattgctgaatatgcc
gatttaaacattcgcatgttcccggcaaaagggtcgttgttgatcatggatcaccgaatc
aatcagcatgtgattaaccgctgccggaagccgtcggatgccgacattctggtgcccggc
gatacaatttcgctgattggcaccacgtctacccatattgattataacgagatagacagc
aaccgcgtcaccgccgaggaagtcgatatactgttacgtgaaggggaaaaactggccccc
atcatggctaagacgcgtattctgcgtgcttattccggcgtccgcccgctggtagccagt
gacgacgatcccagcggccgtaacgtcagccgcggtattgtcctgttcgaccacgccgag
cgcgatggacttgaaggcttcattaccattaccggcgggaagctaatgacttatcgcctg
atggcagaatgggctaccgacgctgtatgccgcaagctgggcaatacccgcccctgcacc
acggcggatacgccgctgcctggctcaaaagagtctacagaacgtacactgaaacgtatt
atctcgcttcccgcgccactacgcggatcggcggtttatcggcacggcgatcgcacgccg
gaatggctaagcgaaggccgccagcatcgtagtctggtctgtgaatgtgaggccgtcacg
gcgggtgaagtacagtatgccgtcgaaaacttaaccgtgaatagcctgctggatctacgt
cgtcgcacccgcgtaggcatgggcacttgccagggcgaattgtgcgcctgccgcgccgcc
gggctattgcagcgttttaatgtgacgaccgccgcgcaatctattacacaactctctgaa
ttcctgaatgaacgctggaagggcgtgcagccgatcgcctggggagacgcgctgcgcgaa
agtgaattcacgcgctgggtttaccagggattatgcggtctggagaaggagcatcaggat
gaaatttga

DBGET integrated database retrieval system