KEGG   Salmonella bongori NCTC 12419: SBG_2254Help
Entry
SBG_2254          CDS       T01579                                 

Definition
(GenBank) putative exported protein
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SBG_2254
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sbg01002]
    SBG_2254
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbg01011]
    SBG_2254
Enzymes [BR:sbg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SBG_2254
Peptidases [BR:sbg01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   SBG_2254
Peptidoglycan biosynthesis and degradation proteins [BR:sbg01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SBG_2254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase DUF5411
Motif
Other DBs
NCBI-ProteinID: CCC31312
UniProt: A0A0K0HD44
LinkDB All DBs
Position
2452715..2454016
Genome map
AA seq 433 aa AA seqDB search
MKSTIVTVALLTFSISAFAVEYPVLTTASPDLVGFDSHKLNRLDGWIQNQIDAGYPSINL
LVIKDNHIVMQKAWGYAKKYEGSTLLADPILATTTTMYDLASNTKMYATNFALQKLVYEG
KINANDLVSKYIPGFKDAPGDKIKGKDRLRIIDILHHEAGFPADPQYPNPNVAGKLFSQN
KSTTLEMIKKTPLEYHPGSKHIYSDVDYMILGFIIESVTAMPLDRYVETTIYKPLGLKHT
VFNPLMKGFTPPQIAATELNGNTRDGEIHFPNIRTSTVWGQAHDEKAWYSMSGVSGHAGL
FSNTHDMAVLMQVMLNGGGYGNVKLFDEKTVEQFTRRSPEEATFGLGWRINSNASMTPTF
GVLASPETYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVADPKVNPNVFVSGLLPAATY
GWIVDQIYGALKK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctactatcgttacggtagcgttacttactttttccatttcagcttttgccgtt
gagtatccggtattgaccaccgccagccctgacctggtgggttttgatagccacaaactt
aaccgacttgatggctggatccaaaatcaaattgatgccggatatcccagtattaatctt
ctggtgatcaaagataatcatatcgtgatgcaaaaagcctggggctatgcgaaaaaatat
gaaggatcgactctgttagccgatcccattctggcaaccacaactacgatgtatgacctg
gcgtcaaatacaaaaatgtatgccactaattttgcattgcaaaaactggtgtatgaagga
aaaatcaatgccaatgatttagtatcaaaatacatacccggttttaaggatgcgcctggt
gataaaattaagggaaaagacaggctccgtatcattgacattcttcatcatgaagctggc
tttcccgccgacccgcaatatcccaatccaaacgtagccggtaaattattctcacaaaat
aaaagcaccacgctggagatgattaaaaagactccgctggaatatcaccccgggtcgaag
catatctatagcgatgtggattatatgattcttggttttatcattgaatcagtaacggca
atgccattagatcgctatgtcgaaacaacgatttataaaccgctcggattaaaacatacc
gtctttaacccgctaatgaaagggttcacgccgccacaaatcgccgcaacggaactcaat
ggcaacacacgtgacggcgagatccatttccctaatattcgcaccagtacagtatggggg
caggcacatgatgaaaaggcctggtactcgatgagcggcgtatcaggacacgccggactc
ttttctaacactcatgatatggctgtgttaatgcaagtcatgctcaatggcggcggatac
ggtaatgtgaagctcttcgatgagaaaacggttgaacagtttactcgccgttcgccagaa
gaggctacctttggcttagggtggcgcataaacagcaacgcctcgatgacgccaacgttt
ggggtattagccagtccagaaacgtatggtcataccggatggactggaacgctaacgtct
atcgatccggttaaccatatggctatcgtgattttaggtaacaggccacactcgccagtg
gcagatcctaaagtgaatccaaacgtttttgtcagtgggttattacctgcggcgacgtat
ggctggattgttgatcagatatatggcgcattgaaaaaataa

DBGET integrated database retrieval system