KEGG   Salmonella bongori NCTC 12419: SBG_2748Help
Entry
SBG_2748          CDS       T01579                                 

Gene name
hyb0
Definition
(GenBank) hydrogenase-2 small chain protein
  KO
K06282  hydrogenase small subunit [EC:1.12.99.6]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00633  Nitrotoluene degradation
sbg01120  Microbial metabolism in diverse environments
sbg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SBG_2748 (hyb0)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SBG_2748 (hyb0)
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With unknown physiological acceptors
    1.12.99.6  hydrogenase (acceptor)
     SBG_2748 (hyb0)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q6 NiFe_hyd_SSU_C TAT_signal
Motif
Other DBs
NCBI-ProteinID: CCC31801
UniProt: A0A0K0HEI8
LinkDB All DBs
Position
complement(3021569..3022687)
Genome map
AA seq 372 aa AA seqDB search
MTGDNTLITSHGINRRDFMKLCAALAATMGLSSKAAAEMAESVSNPQRPPVIWIGAQECT
GCTESLLRATHPTVENLVLETISLEYHEVLSAAFGHQVEENKHNALEKYKGQYVLVVDGS
IPLKDNGIYCMVAGEPIVDHIRKAADGAAAIIAIGSCSAWGGVAAAGDNPTGAVSLQEVL
PGKTVINIPGCPPNPHNFLATVAHIITYGTPPKLDAKNRPTFAYGRLIHEHCERRPHFDA
GRFAKEFGDEGHRQGWCLYHLGCKGPETWGNCSTLQFCDVGGVWPVAIGHPCYGCNEEGI
GFHKGIHQLAHVENQTPRSEKPDVNMKEGGHVSAGAIGLLGGVVGLVAGVSVMAVRELGR
QQKKDNADSRGE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgactggagataatactctcatcacttctcacggcattaatcgccgtgatttcatgaag
ctttgtgcagcactggctgctactatggggctcagtagcaaagccgccgcagaaatggca
gagtcggtatccaatccacagcgtcctcccgttatctggattggcgcgcaggaatgtacc
ggttgtaccgaatcactgcttcgtgctacacaccccaccgttgaaaacctcgttctggag
actatctctctggaataccatgaggtgctttccgctgcttttggccatcaggtcgaagaa
aacaaacataacgctctggagaagtacaaagggcaatatgttctggtggtggatggttct
atcccattaaaagataacggtatttattgtatggttgccggcgagccgatcgtggatcac
atccgcaaagctgctgacggcgccgccgcgattatcgctatcggttcctgctctgcatgg
ggcggcgttgccgcggctggcgacaacccaaccggtgctgtaagtctgcaggaagtgctg
ccgggcaaaacggttatcaatattccaggctgcccgccaaacccacataacttcctggcg
accgtggcacatatcatcacttacggtacgccgccgaagctggatgcgaaaaatcgtcca
acatttgcctatggtcgtctaatccatgagcattgtgaacgtcgtccgcacttcgacgca
ggccgttttgccaaagagtttggcgacgaaggccaccgtcagggctggtgtctctatcac
cttggctgtaaaggaccggaaacctggggcaattgctctacgttgcaattctgcgacgtc
ggtggtgtctggcctgtggcgatcggtcatccttgctatggctgtaacgaagaaggcatc
gggttccataaaggcattcatcaactggcgcatgtcgaaaaccaaactccgcgttccgag
aagcctgacgtcaatatgaaagaaggcggtcatgtttctgcgggggccattggtctgctt
ggtggtgtggttggtctggttgccggtgtcagcgtgatggcggtacgtgaactggggcgt
cagcaaaagaaagataacgctgactcacggggagaataa

DBGET integrated database retrieval system