KEGG   Salmonella bongori NCTC 12419: SBG_2892
Entry
SBG_2892          CDS       T01579                                 

Gene name
gatD
Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00052  Galactose metabolism
sbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SBG_2892 (gatD)
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     SBG_2892 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 2-Hacid_dh_C MTS TrkA_N ADH_zinc_N_2 Shikimate_DH UDPG_MGDP_dh_N 3HCDH_N PrmA Methyltransf_31 Pyr_redox_2 Met_10 Methyltransf_11 CoA_binding Sacchrp_dh_NADP ELFV_dehydrog Pyr_redox Fer4_4
Other DBs
NCBI-ProteinID: CCC31946
UniProt: A0A0K0HEY0
LinkDB
Position
3167983..3169026
AA seq 347 aa
MKSVVIHAEGDVRVEERPVPQLQADDDVLVKVVSSGLCGSDIPRIFAQGAHYYPITLGHE
FSGYVESYGTGVTDMQPGDAVACVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIEDGALIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLALQCA
RELGARSVTAIDINPQKLELAKALGATYTCNSQEMTAADIQNALSDVQFEQLILETAGTP
QTVSLAIDIAGPRAQLALVGTLHHDLTLQAHTFGLILRKELTLLGSWMNYSAPWPGEEWE
TAARLLSEKRLQLSPLIAHRGDAESFAEAVKALNGAPMQGKILLQLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggagacgtacgcgtcgaagaacgccctgtgcca
caactgcaagccgacgacgatgtattggtaaaggtcgtcagttccgggctttgcgggtcg
gatatcccacgtattttcgcgcagggcgcgcattattatcctatcacgttaggtcatgaa
ttcagcggctacgttgaatcctacggcacaggcgtaacggatatgcagcccggcgatgcc
gtcgcttgtgtcccgcttctgccctgttttcactgcccgcaatgcgaacgtggttacttt
tctttatgcaaacagtatcagtttgtaggatcgcgtagcgaaggcggtaatgcagaatat
gtggtggtcaaacgggccaatcttttccgcttgccatctgatatgccgattgaagatggc
gcattgatcgaaccgattaccgtaggcttgcacgcctttcatctggcgcagggctgtgaa
gggaaaaacgttattatcgtcggtgccgggaccattggcttgctggcattacagtgcgcg
cgagaactgggcgcccgcagcgtgacggcgattgatatcaatccgcagaaactggaactt
gcgaaagcgctgggcgcaacgtacacctgtaacagccaggagatgactgccgccgatatt
cagaacgcgttgtccgacgtacagtttgagcaactgatactcgaaacggcaggcactcct
caaaccgtctctctggctatcgatatcgccgggccgcgcgcgcagttggcgctggtcggt
acgttacaccacgacctgactctgcaggcgcacacattcggcttaattttgcgtaaagaa
ctgacgctcctcggcagttggatgaactattccgcgccgtggccaggcgaagagtgggaa
accgcagcgcgtctgttaagcgaaaaacgtcttcaactttcccctctcattgcccatcgt
ggcgatgcagaaagctttgcagaagcggttaaagcgcttaatggcgcccctatgcaaggc
aaaatcctgcttcaactttcctga

DBGET integrated database retrieval system