KEGG   Salmonella bongori NCTC 12419: SBG_3568Help
Entry
SBG_3568          CDS       T01579                                 

Gene name
sodA
Definition
(GenBank) manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sbg  Salmonella bongori NCTC 12419
Brite
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SBG_3568 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CCC32615
UniProt: A0A0K0HGS2
LinkDB All DBs
Position
3935225..3935845
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELIAK
LEQVPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVEKFKEEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtacgcttatgatgcactggaaccgcacttcgat
aagcagacgatggagattcaccacactaaacaccatcaaacctacgtcaataacgctaac
gcggcgctggaaagcctgcctgaattcgctaatctgccggttgaagaactgatcgctaaa
ctggagcaggtaccggcggataagaaaaccgttctgcgcaacaacgctggcggccatgct
aaccacagtctgttctggaagggcctgaaaaaaggcactaccctgcagggcgatcttaaa
gctgcgattgagcgtgatttcggttctgttgagaaattcaaagaagagtttgaaaaagct
gcagcaacccgttttggttccggctgggcgtggctggtgctgaaaggcgataaactggct
gtggtttctaccgctaaccaggactctccgctaatgggcgaagccatttccggcgcgtct
ggcttcccgattctgggtctggatgtgtgggaacatgcttattacctgaagttccagaac
cgtcgcccggactatattaaagaattctggaatgtcgtgaactgggatgaggcagcggcg
cgcttcgcggcgaaaaaataa

DBGET integrated database retrieval system