KEGG   Salmonella bongori NCTC 12419: SBG_3610Help
Entry
SBG_3610          CDS       T01579                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00620  Pyruvate metabolism
sbg00680  Methane metabolism
sbg01100  Metabolic pathways
sbg01120  Microbial metabolism in diverse environments
sbg01200  Carbon metabolism
Module
sbg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SBG_3610 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SBG_3610 (ppc)
Enzymes [BR:sbg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SBG_3610 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CCC32655
UniProt: A0A0K0HH09
LinkDB All DBs
Position
complement(3982207..3984858)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPDLNDA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMGEINNCLKQLDNTDIADYERHQVMRRLRQ
LIAQSWHTDEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVDATPELL
ARVGEEGASEPYRYLMKNLRARLMATQSWLEARLKGEKLPKPAGLLTQNEQLWEPLYACY
QSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGEITRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNDTREVLETCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTVSSLSLYTSAILEANLLPPPEPKDGWRHIMDEL
SVISCQTYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVAKELWPLGKELRDLLEEDIKVVLAIANDSHLMADLPWIAESIQLRNVYTDPLN
VLQAELLHRSRLTEAQGKSPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaggtgctggga
gaaaccatcaaagatgcgctgggagagcacattcttgatcgcgtagaaacaatccgtaag
ctgtccaagtcttcacgcgctggcaatgaagccaatcgccaggaactgctcaccacgctg
caaaatttgtcaaacgacgagttactgccggttgcgcgcgcgtttagtcagttcctgaac
ctggctaacaccgccgagcaataccacagcatttcgccaaaaggtgaagccgccagcaac
ccggaagtaattgcccgcaccctgcgtaaactgaaaaaccaaccggacctcaacgacgca
accatcaaaaaagcggtagagtcgctgtctctggagctggtgctgaccgcacacccgacg
gaaattactcgccgtacgcttattcacaagatgggtgaaatcaacaactgtctgaaacag
cttgataatactgatatcgccgactatgagcgccaccaggtgatgcgccgcctgcgccag
ttgattgcccaatcctggcatacagatgaaatccgcaagcagcgtccaagtccggtagat
gaagccaaatggggcttcgctgtggtagaaaacagcctgtggcagggcgtaccgaactat
ctgcgtgaactgaacgaacagctggaagagaatctcggctacaaactgccagtagatttt
gtgccagtacgttttacctcctggatgggcggcgaccgtgacggcaacccaaacgtgacg
gcggatatcacccgccacgtactcttattaagccgctggaaggccaccgatctgttcctg
aaagatattcaggttctggtatcagaactgtcgatggtcgatgccacgccagaactgctg
gcgcgggtaggcgaagaaggcgcatctgaaccgtatcgctatctgatgaaaaatttgcgc
gcccgcctgatggcgacccagtcctggctggaggcacgtctgaaaggcgagaaactgcct
aaaccggctggtttgttgacgcaaaatgagcagctctgggaaccgctgtacgcctgctac
cagtcgctacaggcctgtggtatgggcattatcgccaacggcgagttgctcgacacatta
cgccgcgtgaagtgtttcggcgtaccgctggtgcgtattgatatccgccaggagagcacc
cgccacaccgaagcgctgggcgaaatcacccgctaccttggtattggtgactacgaaagc
tggtcggaagccgacaagcaggctttcctgatccgcgagctgaattccaaacggccattg
ttgccgcgcaactgggagccgagcaacgatacccgcgaagtgctggaaacctgtaaagtg
attgccgaagcgccgaaaggctcgatcgccgcctacgtgatctcaatggcgaaaacgccc
tccgacgtgctggcagtgcatttgctattaaaagaagcgggcatcgggtttgcgatgcca
gtcgcgccgttgtttgaaacgctggatgacctgaacaacgccgacgacgtgatgacccag
ttgctgaatatcgactggtatcgcggactgattcagggaaaacagatggtgatgatcggc
tactccgactcggcaaaagatgccggggtaatggccgcgtcatgggcgcagtatcaggcg
caggacgcactgatcaaaacctgcgaaaaagccggtattgagctcaccctcttccacggt
cgcggcggttctattggccgtggcggcgcgccagcccacgcggcgttgctctcccaaccg
ccgggtagcctgaaaggcggtttacgcgtgaccgagcagggcgagatgatccgcttcaaa
tatggtctgcctgaagtcaccgtcagcagcctgtcgctctacaccagcgcgatcctggaa
gcaaacctgctgccaccgccggagccaaaagacggctggcgtcatattatggatgagctt
tccgtcatctcctgccaaacctaccgcggctacgtgcgtgaaaataaagactttgtgccc
tactttcgctcggcaacgccggagcaggaactgggtaaattgccgctcggctcacgtccg
gcgaaacgtcgtccaaccggcggcgtcgaatcgctacgcgccattccgtggatcttcgcc
tggacgcagaaccgtctgatgctaccggcctggctgggcgcgggcaccgccctgcaaaaa
gtggtagaagatggcaagcaaagcgaactggaagcgatgtgtcgcgactggccattcttc
tctacgcgtcttgggatgctggaaatggtgttttcaaaagccgacctgtggctggccgag
tattacgatcagcgtctggtagcaaaagaactctggccgctgggtaaagaactacgcgac
ctgctggaagaagacatcaaagtggtgctggcaattgccaacgactcgcacctgatggcc
gacttaccgtggattgcagagtctattcagttaagaaacgtttataccgatccattaaac
gtattgcaggcggagctgctgcatcgttcccgcctgacggaagcgcaaggaaaatcaccc
gatcctcgcgtcgaacaggcgctgatggtcacgattgcgggcgtcgcggctggtatgcgc
aacacgggttaa

DBGET integrated database retrieval system