KEGG   Salmonella bongori NCTC 12419: SBG_3611Help
Entry
SBG_3611          CDS       T01579                                 

Gene name
argE
Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00220  Arginine biosynthesis
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01130  Biosynthesis of antibiotics
sbg01210  2-Oxocarboxylic acid metabolism
sbg01230  Biosynthesis of amino acids
Module
sbg_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SBG_3611 (argE)
Enzymes [BR:sbg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     SBG_3611 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: CCC32656
UniProt: A0A0K0HGV7
LinkDB All DBs
Position
complement(3985241..3986392)
Genome map
AA seq 383 aa AA seqDB search
MKNVLPPFIEIYRALIATPSISATEESQDQSNASLITLLAGWFTDLGFNVEVQPVPGTRN
KFNMLASTGHGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDNKLYGLGTADMKGFFAFI
LDALRDVDVTQLKKPLYILATADEETSMAGARYFSETTALRPDCAIIGEPTSLQPVRAHK
GHISNVVRVLGQSGHSSDPARGVNAIELMHDAVGRIMQLRDSLKERYHYEAFTVPYPTLN
LGHIHGGDASNRICACCELHMDIRPLPGMTLNDLNGLLNEALAPVSERWPGRLTVAELHP
PIPGYECPPDHQLVEVVEKLLGTKTDVVNYCTEAPFIQTLCPTLVLGPGSINQAHQPDEY
LETRFIKPTRELITQVVHHFCWH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgttttaccgccatttatcgagatttaccgcgctctgattgccacaccgtcg
ataagcgcaaccgaagaatcccaggatcaaagcaatgcgtctttaatcactttactggca
ggttggttcaccgatcttggtttcaacgtagaggtccaaccggttccaggaacacgaaac
aaatttaatatgctggccagcaccggacatggggcgggcggtttgctgctggccggtcac
actgacacggttccctttgatgacggacgctggacgcgcgatccctttacgctaactgag
cacgataacaagctctatggtctgggcaccgctgatatgaaaggcttcttcgcctttatt
ctggatgcgctacgtgacgttgacgtcacacagttgaaaaagccgctctacattctggcg
actgccgatgaagagaccagcatggccggggcgcgttatttttccgaaaccaccgcatta
cgtccggactgcgcaatcattggtgaaccgacgtcactgcaaccggtacgcgcgcacaaa
ggacatatctccaatgtcgttcgcgtactgggacaatctggccactccagcgatccagcg
cgtggggttaacgccatcgagctgatgcacgatgcggttggccgtatcatgcaactgcgt
gactcgctgaaagaacggtatcactacgaggcgtttaccgttccgtatccaacgctgaat
ctgggccatattcacggcggcgatgcctcaaaccggatttgcgcctgctgcgaactgcat
atggatattcgtccactgccgggcatgacgttaaatgaccttaatggattgcttaacgag
gcgctggcccctgtaagcgaacgttggccgggccgtctcacggtcgcggagctgcatccg
cccattccgggctacgaatgcccgccggaccatcaactggttgaagtcgtggaaaaactg
ttgggtacgaaaaccgacgtagtgaattactgtactgaagcgccatttattcagacgtta
tgcccaacgctggtgctcggacccggctcaattaaccaggcccatcaaccagatgaatat
ctcgaaacacgttttattaagccaacccgggagttaatcacccaggttgtacatcatttt
tgttggcattaa

DBGET integrated database retrieval system