KEGG   Streptomyces bingchenggensis: SBI_00130
Entry
SBI_00130         CDS       T01678                                 

Definition
(GenBank) putative streptomycin-6-phosphate phosphatase
  KO
K04342  streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00521  Streptomycin biosynthesis
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SBI_00130
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.39  streptomycin-6-phosphatase
     SBI_00130
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase DUF2749
Other DBs
NCBI-ProteinID: ADI03251
UniProt: D7BUR0
LinkDB
Position
complement(123767..125125)
AA seq 452 aa
MHRPSRRHLVIGTAVVAATAAAVAVSTTAGASDSKDRAESAIKGGKAKNVILLIGDGMGD
SEITLARDYTAGANGRLNMDKFPLTGAYTTYAVHADGTPDYVTDSAASGTGWATGRKTVN
GRISKTPDTDKAIPTVLELAQKNGYATGSVTTAELTDATPAVLASHATDRSCQGPADMAK
CPTDTIAAGGPGSIAEQSVNHKVDVLFGGGKARFDQKVTDGTYKGLTVTEQARKLGYQVV
TDSAGMKSAQAGKPVLGLFASGNVPTEWTGKTAAVGGTDPQRCVTSNPNRPSTTPSLADS
ATKAIQLLEAKQKHSGKGFFLQIEGASIDKQDHAADPCGQIGETAAFDRAVKVARDYAAK
HPDTLVVTTADHGHTSQIVPLEATPPGLSSTLVTNEGQQLKVNYSTNTPGQSQEHTGTQV
RIAGQGPQAYRVLGVTNQTDLFATIREALNLR
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcacagaccctcccgtcgtcacctcgtgatcggcaccgccgtggtcgccgccaccgcg
gccgcagtggccgtcagcaccaccgccggagcctccgacagcaaggaccgcgccgagagc
gcgatcaagggtggcaaggcaaagaacgtcatcctgctgatcggcgacggtatgggcgac
tcggagatcaccctcgcccgtgactacacggcgggcgcgaacggccgcctgaacatggac
aagttcccgctcaccggcgcctacaccacctatgcggtgcacgccgacggcaccccggac
tacgtcacggactccgccgccagcggcaccggctgggcgaccggccgcaagacggtcaac
ggccgcatctccaagaccccggacaccgacaaggcgatccccaccgtcctggagctggcg
cagaagaacggctacgccaccggcagcgtcaccaccgccgagctcaccgacgccaccccg
gccgtgctcgcctcgcacgccaccgaccgctcctgccagggcccggccgacatggccaag
tgccccaccgacaccatcgccgccggcggccccggctcgatcgccgagcagtccgtcaac
cacaaggtcgacgtcctcttcggcggcggcaaggcgcggttcgaccagaaggtcaccgac
ggtacgtacaagggcctgaccgtcaccgagcaggcgcggaagctgggctaccaggttgtc
accgactccgccggtatgaagagcgcgcaggccggcaagccggtgctgggtctgttcgcc
tcgggcaatgtgcccaccgagtggaccggcaagacggccgcggtcggcggtacggacccg
cagcggtgcgtgacctcgaaccccaaccgcccgtcgaccacgccgagtctggccgactcc
gccaccaaggcgatccagctgctggaggccaagcagaagcactcggggaagggcttcttc
ctgcagatcgagggtgcctccatcgacaagcaggaccacgcggccgacccgtgcggccag
atcggcgagaccgccgccttcgaccgtgccgtgaaggtggcccgcgactacgccgccaag
caccccgacacgctcgtcgtgaccaccgccgaccacggtcacaccagccagatcgtcccg
ctggaggccaccccgcccggtctgtcctccaccctggtcaccaacgagggccagcagctc
aaggtcaactactccaccaacaccccgggccagtcccaggagcacaccggtacccaggta
cgcatcgcaggccaggggccgcaggcgtaccgcgtcctcggtgtcaccaaccagaccgac
ctgttcgccaccatccgcgaggctctgaacctgcgctga

DBGET integrated database retrieval system