KEGG   Streptomyces bingchenggensis: SBI_01604
Entry
SBI_01604         CDS       T01678                                 

Definition
(GenBank) putative aldehyde lyase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00997  Biosynthesis of various secondary metabolites - part 3
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SBI_01604
Enzymes [BR:sbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     SBI_01604
SSDB
Motif
Pfam: DeoC NMO
Other DBs
NCBI-ProteinID: ADI04725
UniProt: D7CFI9
LinkDB
Position
2177539..2178354
AA seq 271 aa
MAGDDKHLLVPLDHSVSDGPIVPAGQWPDLLRALVAGGADGIVVHKGRARALAPDILKSC
ALVVHLSASTACSADVNAKVLVGDVEEALRLGADAVSVHVNIGSDTEAQQLADLGAVARS
CDAWGMPLIAMVYPRGPRIENPHDPALLAHLVNVAADLGADMVKTSVALPLDRMAEVVAN
SPIPILAAGGPPDGSDLIEYGTAVMASGCRGLAIGRRVFTSPSPAALVSRLSAVVHGGSG
GSGGDGTEPAARPDGRTDDMAHYSTMVAGIA
NT seq 816 nt   +upstreamnt  +downstreamnt
ttggcgggtgacgacaaacacctgctcgtgccactcgaccacagcgtctcggacggcccg
atcgtccccgccggccagtggcccgatctgctgcgggcgctggtggccggcggggcggac
gggatcgtcgtccacaagggacgcgcccgcgccctcgcaccggacatcctcaaaagctgc
gccctggtggtgcacttgagcgccagtaccgcctgctccgccgatgtcaacgccaaggtg
ctggtcggcgatgtcgaggaggcgttgcggctcggtgcggacgcggtcagcgtccatgtg
aacatcgggtcggacaccgaagcgcagcagctcgccgatctgggggcggtggcccgctcc
tgcgatgcgtggggcatgccgctgatcgcgatggtctacccccgcggcccgcggatcgag
aacccacacgatcccgccctgctcgcgcatctggtcaatgtcgccgcggatctgggcgcc
gacatggtgaagacctccgtcgccctgccgctcgaccgaatggccgaggtggtggccaac
agccccatccccatcctggcggccggaggcccaccggacggctccgacctcatcgaatac
ggcactgccgtcatggcctccggctgtcgggggctggccatcggccgccgggtcttcacc
tccccctcacccgccgcgctggtgtcccggctctccgcggtcgtacacggcggcagtggc
ggcagcggcggcgacggcaccgaaccggcggcgcgtcccgacggacggaccgatgacatg
gcccattactcgacgatggtggcaggtatcgcatga

DBGET integrated database retrieval system