KEGG   Streptomyces bingchenggensis: SBI_02055Help
Entry
SBI_02055         CDS       T01678                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SBI_02055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sbh03400]
    SBI_02055
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SBI_02055
DNA repair and recombination proteins [BR:sbh03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SBI_02055
 Prokaryotic type
     SBI_02055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ADI05176
UniProt: D7BRL3
LinkDB All DBs
Position
2808844..2809521
Genome map
AA seq 225 aa AA seqDB search
MAARPLNEIVEAGWAKALEPVEERIAAMGDFLRAEIAAGRTYLPAGQNVLRAFQQPFDEV
RVLIVGQDPYPTPGHAVGLSFSVAPEVRPLPGSLENIYRELHTDLGLPRPSNGDLTPWTA
QGVLLLNKALTTAPRRPAAHRGKGWEEVTEQAIRALAARGRPLVSILWGRDARNVRPLLG
SLPAIESAHPSPMSADRGFFGSRPFSRANDLLVQQGAQPVDWRLP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtggctgcacgacccttgaacgaaatcgtagaagcaggctgggccaaggcacttgagccg
gtcgaagaacgtatcgccgcgatgggcgacttcctgcgggccgagatagcggcagggcgc
acttatctgccggccggacagaatgtgctgcgcgccttccagcagcccttcgacgaggtg
cgcgtcctgatcgtcggtcaggacccctatccgacgcccggccacgccgtggggctcagc
ttctccgtggccccggaggtgcgcccgctgcccggcagcctggagaacatctaccgcgag
ctgcacaccgacctcggcctgccccgcccgtccaacggcgatctgaccccgtggaccgcg
cagggcgtgctgctgctcaacaaggcgctgaccaccgcgccgcgccggcccgccgcgcac
cgcggcaagggctgggaggaggtcaccgagcaggccatccgggcgctggccgcgcgcggc
cgccccctggtgtccatcctgtggggccgcgacgcccggaacgtgcgcccgctgctcggc
agcctgcccgccatcgaatccgcgcacccctcccccatgtccgccgaccgcggcttcttc
ggctcacgtccgttcagccgggccaatgaccttctggtacagcaaggggcccagccggtg
gactggcgccttccctga

DBGET integrated database retrieval system