KEGG   Streptomyces bingchenggensis: SBI_02198Help
Entry
SBI_02198         CDS       T01678                                 

Gene name
bga7
Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SBI_02198 (bga7)
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SBI_02198 (bga7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_14 Glyco_hydro_35 Glyco_hydro_2_C Cellulase
Motif
Other DBs
NCBI-ProteinID: ADI05319
UniProt: D7BTA4
LinkDB All DBs
Position
complement(2973301..2975388)
Genome map
AA seq 695 aa AA seqDB search
MISTLLSRLPHGSDGDPASPRLVFGADYNPEQWPRGVWGEDVRLMRQAGVNAVSVAIFSW
ARIQPAPDQWDFGWLDEVMDLLHAGGIGVDLATATASPPPWLTTAHPEILPVTAAGETVW
PGARQHWRPTSPVFREHALRLVAEMARRYADHPALVAWHVSNELGCHNIYDYSDDAARAF
RDWLRARYGTLDALNHAWGTAFWSQRYSDWAQILPPRLAASHPNPTQQLDFKRFSSDALK
EYLRAERDILREITPGVPVTTNFMVMGETKGMNYPDWADEIDFVSNDHYVLPGPQDRDEL
SFSANLTSGIAGGRPWFLMEHSTSAVNWQPINVAKRPGDLARDSLLHVAHGADAVCFFQW
RQSAAGAEKYHSAMVPHAGADSDVFRAVTELGATLQALAPVAGAERERARVGIVYDWDSW
WASEQDSHPSSRLNYRQEALDWYSALLALGIRADVITTRADLDEYRLLIAPVLHVVPQAL
AKELTRYVETGGHLVTTYFSGVVDENDHVWLGGYPGALRELLGIRIEEFGPLLAEDTVEL
DGLDGPNGANGAGTPATGTLWTDQITVTDPEVRTLAHYRTGTYAGRPAITRRAAGQGSAA
YVSTRLGPDGLARLLPGLLEGTGVHSELPAEVRGRVELTVRRTADARYLFLVNRTDEQVS
LPGLTGEPLTGGATAADGALTLRPREVAVVRQPAS
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaccctcctctcccggctgccgcacgggtcggacggtgaccccgcctccccc
cgcctggtcttcggcgccgactacaaccccgagcagtggccgcgtggggtgtggggggag
gacgtccggctgatgcgccaggccggcgtcaatgccgtctccgtggcgatcttctcctgg
gcccgcatccagccggccccggaccagtgggacttcggatggctcgacgaggtcatggac
cttctgcacgcgggcggcatcggggtcgacctggccaccgccaccgcgtccccgccgccc
tggctgaccaccgcgcacccggagatcctgccggtcactgccgccggtgagacggtatgg
ccgggggcgcgccagcactggcgccccacctcgccggtcttccgcgagcacgcgctgcgc
ctggtggccgagatggcccggcgctacgccgaccaccccgccctggtggcctggcatgtg
tccaacgagctgggctgccacaacatctacgactactccgacgacgccgcccgcgccttc
cgcgactggctgcgtgcgcgctacgggaccctggacgcgctcaaccacgcctgggggacc
gcattctggtcccagcgctacagcgactgggcgcagatcctgccgccccggctggccgcg
tcccaccccaaccccacccagcagctcgacttcaagcgcttctcctccgacgcgctgaag
gagtatctgcgcgcggagcgggacatcctgcgcgagatcaccccgggcgtgcccgtgacc
accaacttcatggtgatgggcgagaccaaggggatgaactaccccgactgggccgacgag
atcgacttcgtctccaacgaccactacgtcctccccggcccccaggaccgcgacgagctg
tccttctccgccaacctcaccagcggtatcgcgggcgggcgcccgtggttcctcatggag
cactccaccagcgcggtcaactggcagcccatcaacgtggccaagcgcccgggcgacctc
gcgcgcgactctctgctgcacgtcgcgcacggcgccgacgcggtctgcttcttccagtgg
cggcagtcggcggccggggccgagaagtaccactcggcgatggtgccgcacgccggggcc
gacagtgatgtcttccgcgcggtgaccgagctgggcgccacccttcaggcgctggcgccg
gtcgccggggccgagcgcgagcgggcgcgggtcgggatcgtatacgactgggactcgtgg
tgggccagtgagcaggactcccaccccagctcccggctcaactaccgccaagaggccctt
gactggtactccgcccttctcgcgctgggcatccgcgccgatgtcatcaccacccgggcc
gacctcgacgagtaccggctgctgatcgctcccgtactgcatgtggtgccccaggccctg
gccaaggagctcacgcggtacgtggagacgggcggccacctggtgaccacgtacttctcc
ggcgtcgtcgacgagaacgaccatgtctggctgggcggctaccccggggccctgcgcgaa
ctgctgggcatccgcatcgaggagttcggcccgctgctcgccgaggacaccgtcgaactg
gacggcctggacggcccgaacggtgcgaacggtgcgggaaccccggccaccggcaccctg
tggaccgaccagatcaccgtcaccgaccccgaggtgcgcaccctcgcccactaccgcacc
ggcacctacgccggccgccccgccatcacccgccgcgccgcgggccagggctcggccgcg
tatgtctccacccggctgggccccgacgggctcgcccgcctgctgccgggcctgctggag
ggcaccggagtccacagcgagctgcccgccgaggtgcgcgggcgcgtcgagctgacggtg
cgccgcaccgccgacgcccgttacctcttcctcgtcaaccgcaccgacgagcaggtgagc
ctgcccggcctcaccggggagccgctgaccggcggcgccacggcggccgacggcgcgctc
accctgcggccgcgggaggtcgccgtggtgcgacagcccgcctcctga

DBGET integrated database retrieval system