KEGG   Streptomyces bingchenggensis: SBI_02491Help
Entry
SBI_02491         CDS       T01678                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00020  Citrate cycle (TCA cycle)
sbh00480  Glutathione metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
sbh01210  2-Oxocarboxylic acid metabolism
sbh01230  Biosynthesis of amino acids
Module
sbh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBI_02491
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SBI_02491
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SBI_02491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ADI05612
UniProt: D7BYQ3
LinkDB All DBs
Position
3330134..3332353
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVQAYASTAGVTVETRDISLAGRLIAVFPEYLEEGL
RIPDALAELGELAKTPEANIIKLPNISASIPQLKAAVAELQQQGYALPDYPDDPKTDEER
EIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWSADSKTNVATMGVDD
FRSTEKSAVISEAGSLRIELAGDDGSTTVLRESVPVLAGEVVDASVMRVAALREFLTAQV
ARAKAEDVLFSLHLKATMMKVSDPIVFGHGVRAFFPKTFAAYGEVFAAAGLTPNDGLGGI
LKGVESLPEGAKIKESFEAELAEGPRLAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEADTLAVLPDSSYAGVYQAVLDDCRANGALDPATIGSVPNVGLMAQKAEEYGS
HDKTFEIPATGTVRVLDEAGNVVLEQVVGAGDIFRMCQTKDLPIRDWVKLAVTRARATGD
PAVFWLDENRAHDAQLIEKVKAYLPEHDTEGLRIEIMAPVEATKFSLERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSLEQYAKTTGNARATVLADTLDRATATFLNEDKSPSRRVGGIDNRGSHFY
LALYWAQELAKQTDDADLAKAFAPLAETLAAQEQTIVDELIAVQGEPADIGGYYQPDPAK
AAAVMRPSATFNEALATLG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacaccgacgaggccccggccctggcgacgtat
tcgttcctgccggtggtccaggcctacgcgtcgacggccggtgtcactgtggaaacccgt
gacatctcgctggccgggcgcctcatcgccgtcttccccgagtacctggaggagggcctg
cggatccccgacgccctcgccgagctcggcgagctggccaagacgcctgaggccaacatc
atcaagctgccgaacatctcggcctcgatcccgcagctgaaggccgcggtcgccgagctc
cagcagcaggggtacgcgctgccggactacccggacgaccccaagaccgacgaggagcgc
gagatccgcgcccgctacgacaaggtcaagggctccgccgtcaacccggtgctgcgcgag
ggcaactccgaccgccgcgcccccgcgtcggtcaagaactacgccaagacgcacccgcac
cgcatgggcgcctggtccgccgactcgaagaccaacgtcgccaccatgggcgtcgacgac
ttccgctccaccgagaagtccgcggtgatctccgaggccggttcgctgcgcatcgaactg
gcgggcgacgacggctcgaccaccgtgctgcgcgagtcggtacccgtgctggcgggcgag
gtcgtggacgcgtccgtgatgcgggtggcggcgctgcgtgagttcctcaccgcgcaggtg
gcccgcgccaaggccgaggacgtgctgttctcgctgcacctgaaggccacgatgatgaag
gtctccgacccgatcgtcttcggccacggggtgcgggccttcttcccgaagaccttcgcc
gcgtacggtgaggtgttcgccgcggccgggctgacccccaacgacgggctcggcggcatc
ctcaagggcgtggagtcgctgcccgagggcgccaagatcaaggagtccttcgaggccgag
ctggccgagggcccccgcctggcgatggtcgactccgaccgcggcatcaccaatctgcac
gtcccctccgacgtcatcgtcgacgcctccatgccggccatgatccgcacctccggccat
atgtggggccccgacggccaggaggccgacaccctcgccgtcctccccgacagcagctac
gccggtgtctaccaggccgtcctcgacgactgccgggccaacggcgccctggaccccgcc
accatcggctcggtccccaacgtcggtctgatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatccccgcgacgggcaccgtccgcgtcctcgacgaggccggc
aacgtggtcctggagcaggtcgtcggcgccggtgacatcttccggatgtgccagaccaag
gacctgccgatccgcgactgggtcaagctcgccgtcacccgcgcccgcgccaccggcgac
ccggcggtcttctggctcgacgagaaccgcgcccacgacgcccagctgatcgagaaggtc
aaggcgtacctgcccgagcacgacaccgagggcctgcggatcgagatcatggccccggtc
gaggcgaccaagttctcgctggagcgcatccgccgcggcgagaacaccatctcggtcacc
ggcaatgtgctgcgcgactacctgaccgacctgttccccatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggcggcctgttcgagaccggcgcc
ggcggctcggcgcccaagcacgtccagcagctggtcaaggagaactacctgcgctgggac
tcgctgggcgagttcttcgcgctggtgccgtccctcgagcagtacgcgaagaccaccggc
aacgcgcgcgccacggtgctcgccgacaccctcgaccgggccaccgccaccttcctcaac
gaggacaagtcgcccagccgccgggtcggtggcatcgacaaccgcggcagccacttctac
ctggccctgtactgggcgcaggagctggccaagcagaccgacgacgcggacctggccaag
gccttcgccccgctcgccgagacgctggccgcccaggagcagacgatcgtcgacgagctg
atcgccgtccagggcgagccggccgacatcggcggctactaccagcccgacccggccaag
gccgccgccgtgatgcgtccgtcggcaaccttcaacgaggccctcgccaccctcggctga

DBGET integrated database retrieval system