KEGG   Streptomyces bingchenggensis: SBI_02505Help
Entry
SBI_02505         CDS       T01678                                 

Definition
(GenBank) hypothetical protein
  KO
K07228  TrkA domain protein
Organism
sbh  Streptomyces bingchenggensis
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SBI_02505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C
Motif
Other DBs
NCBI-ProteinID: ADI05626
UniProt: D7BYR7
LinkDB All DBs
Position
3344736..3345227
Genome map
AA seq 163 aa AA seqDB search
MAVGAPRISSTPLPGIGVRYDLTTREHRRLSVVAHRDGGRTLSSYHEDDPDECAMSVRLT
AKEAEAVIDALMPSHHSPALLSTTELGLVAERVELSSVSYWNGRVLGETRMRTETGASIV
AVLRRAEAIPSPTPDFRLAGGDTLIVIGTREGVETAAAILGRE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgggcgctccgcggatcagcagcacgccgttgcccggaatcggtgtccgttac
gacctgaccacgcgcgagcaccgccgactgtcggtggtcgcgcatcgtgacggcgggcgg
accctgagctcgtatcacgaggacgatcccgacgagtgcgccatgtcggtgcggctgacg
gcgaaggaggcggaggcggtcatcgacgcgctgatgccctcccaccacagcccggcgctg
ctgtccacgacggagctggggctggtggccgagcgcgtcgagctgtcgtcggtctcgtac
tggaacgggcgggtcctgggcgagacgcggatgcgcaccgagaccggcgcctcgatcgtg
gcggtgctgcgccgcgcggaagcgatcccctccccgacgccggacttccggctggccggc
ggcgacaccctgatcgtgatcggcacccgcgaaggcgtggagacggccgcggcgatactc
gggcgggagtga

DBGET integrated database retrieval system