KEGG   Streptomyces bingchenggensis: SBI_02780Help
Entry
SBI_02780         CDS       T01678                                 

Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00380  Tryptophan metabolism
sbh00630  Glyoxylate and dicarboxylate metabolism
sbh01110  Biosynthesis of secondary metabolites
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SBI_02780
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SBI_02780
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     SBI_02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ADI05901
UniProt: D7C2L8
LinkDB All DBs
Position
3660666..3662765
Genome map
AA seq 699 aa AA seqDB search
MTDRKERQREMYRAADPAEGPLTTDQGVAVDHTDDSLTVGERGPTLMEDFHFREKLMHFD
HERIPERVVHARGAGAYGYFEPYESCAEFTRAAFLQDPSVSTPVFVRFSTVQGPRGSSDT
VRDVRGFATKFYTSEGNYDLVGNNMPVFFIQDGIKFPDFVHALKPEPQNEIPTGASAHDT
LWDFVSLQPETMHMMMWLMSDRAIPRSFRMMQGFGVHTFRFVDARGRGTFVKFHWKPKLG
VHSLVWDEAQECQGRDADFNRRDLWQAIEAGEYPEYELGVQLVPEEDEFTFDFDLLDATK
IIPEEQVPVRPIGHMVLNRNPENFFAETEQVAFHTGNVVPGIDFTNDPLLQARNFSYLDT
QLIRLGGPNFAQLPVNQPVAPVRTNQRDGYHQSAIHSGTSYSPNSLGGGCPAIAGPDGYA
FSHYAERVDGAKIRKRSESFKDFYSQAALFWNSMSDWERRHIVDAFRFELGKVGAVEVRE
RTVGELAHIDQTLATAVAEGIGVAPPAPVNTEHKPVASPALSLENLRGDGSIRTRQIAVL
VTDGVDTEQLTQAQEALSAQGAVVEALADHDGKVRGADGNGYAVDRALPTVASVLYDAVL
LPGGPTGTPELRSDETAMRFVRDAYRHGKAIGALGSGVGILSALEPEGLHIASGHGHVCA
DRGVVTDATTGTASEEFTRTFTEAIAAHRHWDRPRLPTC
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgaaaggaacggcagcgcgagatgtaccgcgccgccgaccccgccgagggg
ccgctgaccacggaccagggggtggcggtcgaccacaccgacgactcgctcaccgtgggt
gagcgcggcccgacgctgatggaggacttccacttccgcgaaaagctcatgcacttcgac
catgagcggatcccggagcgggtggtgcacgcacggggcgcgggcgcgtacggatacttc
gagccgtacgagtcctgtgcggagttcacccgggccgccttcctccaggacccgtccgtg
agcactccggtgttcgtccggttctcgacggtgcaggggccgcgcggctcgtcggacacg
gtgcgcgatgtgcgcggcttcgccacgaagttctacacctccgaaggcaactacgacctg
gtcggcaacaacatgccggtgttcttcatccaggacggcatcaagttcccggacttcgtg
cacgcgctcaagcccgaaccgcagaacgagatccccaccggcgcgtccgcccacgacacg
ctgtgggacttcgtgtccctgcagcccgagaccatgcacatgatgatgtggctgatgtcc
gaccgggccatcccgcgcagcttccgcatgatgcaggggttcggggtgcacaccttccgg
ttcgtggacgcgcggggccgggggacctttgtgaagttccactggaagcccaagctcggg
gtgcactcgctggtctgggacgaggcgcaggagtgccagggccgggacgcggacttcaac
cggcgcgatctgtggcaggcgatcgaggcgggcgagtacccggagtacgagctgggggtg
cagctggtcccggaggaggacgagttcaccttcgacttcgatctgctcgacgccacaaag
atcattccggaggagcaggtgccggtccggcccatcggccacatggtgctgaaccgcaac
ccggagaatttcttcgccgaaaccgagcaggtggccttccacaccggcaatgtggtgccc
ggtatcgacttcaccaacgacccgctgctgcaggcccgtaacttctcgtatctggacacc
cagctgatccggctgggcgggcccaacttcgcgcagctcccggtcaaccagccggtggcc
ccggtccgcaccaaccagcgcgacggctaccaccagagcgccatccacagcgggacgagc
tactccccgaactcgctgggcggcggctgccccgctatcgccggcccggacggatacgcg
ttctcgcactacgccgagcgggtcgacggcgccaagatccgcaagcgcagcgagagcttc
aaggacttctacagccaggccgcgctgttctggaacagcatgagcgactgggagcggcgg
cacatcgtcgacgcgttccgcttcgagctgggcaaggtcggcgcggtggaggtgcgtgag
cgtacggtcggcgagctggcgcatatcgaccagaccctggccacggccgtggccgagggc
atcggggtggcgccccccgccccggtgaacaccgagcacaagcccgtggcctcccccgcg
ctcagcctggagaacctgcgcggcgacggctccatccgcacccgccagatcgcggtgctg
gtcaccgacggggtggacaccgaacagctcacccaggcccaggaagcgctgagcgcgcag
ggcgccgtcgtcgaggccctggccgaccacgacgggaaggtgcgcggcgccgacgggaac
ggctatgcggtggaccgggcgctgccgacggtcgcctcggtgctctacgacgcggtgctg
ctgcccggcgggccgaccggcaccccggagctgaggtcggacgagacggcgatgcggttc
gtccgggacgcctaccggcacggcaaggcgatcggggcgctgggctcgggcgtgggcatc
ctgtccgcgctggagccggagggcctgcacatcgcctcgggccatgggcatgtgtgcgcg
gaccggggtgtggtcacggacgccacgaccgggacggcgagcgaggagttcacccggacc
ttcaccgaggccatcgccgcccaccggcactgggaccgcccccggctgcccacctgctga

DBGET integrated database retrieval system