KEGG   Streptomyces bingchenggensis: SBI_02886Help
Entry
SBI_02886         CDS       T01678                                 

Definition
(GenBank) hypothetical protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00250  Alanine, aspartate and glutamate metabolism
sbh00410  beta-Alanine metabolism
sbh00640  Propanoate metabolism
sbh00650  Butanoate metabolism
sbh01100  Metabolic pathways
sbh01120  Microbial metabolism in diverse environments
Module
sbh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SBI_02886
   00650 Butanoate metabolism
    SBI_02886
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SBI_02886
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SBI_02886
Enzymes [BR:sbh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SBI_02886
Amino acid related enzymes [BR:sbh01007]
 Aminotransferase (transaminase)
  Class III
   SBI_02886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADI06007
UniProt: D7C2X4
LinkDB All DBs
Position
complement(3784431..3785774)
Genome map
AA seq 447 aa AA seqDB search
MNSELHDRHKAVLPDWIALYYERPIELTHGEGRHVWDADGNRYLDFFGGILTTMTAHALP
EVTKAVSEQAARILHSSTLYLDRPMVELAERVAELSGIPDPRVFFTTSGTEANDTALLLA
TTYRRSNQILAMRNSYHGRSFSTVGITGNRSWSPTSLSPLQTLYVHGGVRGRGPYAGLSD
AEFIKACTADLEDVLGQACGQVAALIAEPVQGVGGFTSPPDGLFAAFREVLDRHGILWIS
DEVQTGWGRTGDNFWGWQAHDASGPPDVLTFAKGIGNGMSIGGVVARAEVMNCLGANSIS
TFGGSPITMAAGLANLTHLLEHDLQGNARRVGGLLMDRLRTAAAGLDVVREVRGRGLMIG
IELVEPGSDRPSPDAASAVLEAAREGGLLLGKGGGHNSSVLRIAPPLSLTAAEAEEGAEI
LATALRTAQAMADGSAEAADEAGRSTL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagcgagctccacgaccgccacaaggccgttctgcccgactggatcgccctctac
tacgagcggccgatcgagctcacgcacggcgagggccgccatgtctgggacgccgacggc
aaccgctacctcgacttcttcggcggcatcctcaccaccatgaccgcccacgccctcccc
gaggtcaccaaggcggtcagcgaacaggcggcgcggatcctgcacagctccacgctctat
ctcgaccgccccatggtggagctggccgagcgcgtcgccgagctgtcaggcatccccgac
ccgcgcgttttcttcaccacttccggcaccgaggccaatgacacggccctgctcctggcc
accacgtaccggcgctccaaccagatcctggcgatgcgcaacagctaccacggccggtcc
ttctcgaccgtcggcatcaccggcaaccgctcgtggtcgccgaccagcctgtcgccgctg
cagacgctgtacgtgcacggcggggtgcgcggccgcggcccgtatgccgggctgtcggac
gccgagttcatcaaggcgtgcaccgccgatctggaggatgtgctgggccaggcgtgcggg
caggtcgcggcgctgatcgcggagcccgtgcagggcgtcggcgggttcacctcaccgccg
gacgggctgttcgccgccttccgggaggttctggaccggcacgggatcctgtggatcagc
gacgaggtgcagaccggctgggggcggaccggcgacaacttctggggctggcaggcacac
gacgcctccggcccgcccgacgtcctcaccttcgccaagggcatcggcaacggcatgtcc
atcggcggtgtcgtcgcccgcgccgaggtgatgaactgtctgggcgccaactccatctcc
accttcggcggcagcccgatcaccatggccgccggcctcgccaacctgacccacctcctc
gaacacgatctgcagggcaacgcgcgccgcgtgggcgggctgctcatggaccggctgcgc
accgcggcggccgggctggacgtcgtacgcgaggtgcgcggccgggggctgatgatcggc
atcgagctggtcgagccgggcagcgaccggccctcgcccgacgcggcctcggccgtcctg
gaggccgcgcgtgagggcgggctgctgctcggcaagggcggcggccacaacagcagcgtg
ctgcgtatcgccccgccgctgagcctgaccgccgccgaggccgaggagggcgcggagatc
ctggcgacggcgctccgcacggcgcaggccatggcggacggttcggcggaggcggccgac
gaggccggaaggagcaccctctga

DBGET integrated database retrieval system