KEGG   Streptomyces bingchenggensis: SBI_02996Help
Entry
SBI_02996         CDS       T01678                                 

Definition
(GenBank) hypothetical protein
Organism
sbh  Streptomyces bingchenggensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ADI06117
UniProt: D7C4R6
LinkDB All DBs
Position
complement(3921145..3922173)
Genome map
AA seq 342 aa AA seqDB search
MTAQGTALRFGYGTNGLADLRLDDALALLADLGYDGVGLTLDHMHLDPLAPDLAARTRRA
GRRLAALGLDATVETGARYVLDPRRKHGPSLLDPDPEARARRVDLLVRAVRVAADLGAHA
VHCFSGTVPPADDAATSDAATAWQRLAASLTPVLEAADTAGIPLAIEPEPGHLLATLADF
HHLRRLLGDPPALGLTLDLGHCQCLEPLPPADCVRAAAPWLRHVQIEDMRRGVHDHLPFG
EGEMDFPPVLAALAATGYQGLTVVELPRHSHAGPHYAETSLPFLRRAAAAAAATVPLTAV
SGAAPGAASDAAAPAATSGAAPATDTPAATAPAITVPEGSAP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccaggggacagccctccggttcggctacggcaccaacggcctcgccgacctc
cgcctcgacgacgccctcgccctcctcgccgacctcggctacgacggcgtcggcctgacc
ctcgaccatatgcacctcgacccgctcgcccccgacctcgccgcccgcacccggcgggcc
ggccggcgcctggccgccctcggcctcgacgccaccgtggaaaccggcgcccgctacgtc
ctcgacccccgccgcaaacacggcccctcgctcctcgacccggacccggaggcccgcgcc
cgccgcgtggaccttctggtgcgcgcggtccgggtggccgccgacctcggtgcgcacgcc
gtgcactgcttcagcggaaccgtcccgcccgccgacgacgcggccaccagcgacgcggcc
acggcctggcagcggctggccgcatccctcaccccggtcctggaagccgccgacactgcc
gggatcccgctcgctatcgagcccgaacccggccacctcctcgccaccctcgccgacttc
caccacctccgccgcctcctcggcgacccgcccgcgctgggcctcaccctggacctcggc
cactgccagtgcctggaacccctgccgcccgccgactgtgtacgcgccgccgcgccctgg
ctgcggcacgtccagatcgaggacatgcggcgcggcgtccacgaccacctcccgttcggg
gagggcgagatggacttcccgcccgtcctcgcggcgctcgccgcgaccggctaccagggc
ctgacggttgtcgagctgccccgccactcccacgccggcccccactacgccgagacctcc
ctgccgttcctgcgccgcgctgccgctgccgcggcggccaccgtgccgcttaccgcagtc
tcgggcgctgccccgggcgcggcctcggacgccgctgccccggccgccacctcgggcgct
gccccggccactgacaccccggcggccaccgcccccgccatcaccgtgccggaagggagc
gccccatga

DBGET integrated database retrieval system