KEGG   Streptomyces bingchenggensis: SBI_03883Help
Entry
SBI_03883         CDS       T01678                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00020  Citrate cycle (TCA cycle)
sbh00310  Lysine degradation
sbh00380  Tryptophan metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Module
sbh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBI_03883 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    SBI_03883 (kgd)
   00380 Tryptophan metabolism
    SBI_03883 (kgd)
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SBI_03883 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ADI07004
UniProt: D7CHE7
LinkDB All DBs
Position
4979281..4983111
Genome map
AA seq 1276 aa AA seqDB search
MSPQSPNSSSVSTDQQDGQGSNPAAAFGPNEWLVDEIYQQYLQDPNSVDRAWWDFFADYK
PGQDTSSAVAESAPAPAAGGAAGTGAAAPAPVSNGAAPAPVKPAAPAVPPAAQQAAPAPA
PVKPAAPAPAAAPAKAAPAAKTAPAKAAEPAAPGAGPEYVTLRGPSAAVAKNMNASLQLP
TATSVRAVPVKLLFDNRIVINNHLKRARGGKVSFTHLIGYAMVQALKAMPSMNHSFTEKD
GKPTLVKPEHINLGLAIDLVKPNGDRQLVVAAIKKAETLNFFEFWQAYEDIVRRARANKL
TMEDFTGVTASLTNPGGIGTVHSVPRLMPGQGLIIGVGAMEYPAEFQGTSQDTLNKLGIA
KVMTLTSTYDHRVIQGAASGEFLRIMSQLLLGENDFYDEIFKALRIPYEPVRWLRDIDVS
HDDDVTKAARVFDLIHSYRVRGHVMADTDPLEYRQRKHPDLDIIEHGLTLWDLEREFAVG
GFAGKTMMNLRDILGVLRDSYCRTTGIEFMHIQDPKQRKWIQDRVERPHAKPERDEQLRI
LRRLNAAEAFETFLQTKYVGQKRFSLEGGESVIPLLDAVLDAAAESRLDEVVIGMAHRGR
LNVLANIVGKSYAQIFREFEGNLDPKSMHGSGDVKYHLGAEGTFTGLDGEQIAVSLTANP
SHLEAVDPVLEGVVRAKQDIIGKAGTDFTVLPVALHGDAAFAGQGVVAETLNMSQLRGYR
TGGTVHIVINNQVGFTAAPAASRSSMYATDVARMIEAPIFHVNGDDPEAVVRVARLAFEF
RQAFNKDVVIDLICYRRRGHNETDNPGFTQPLMYDLIDKKRSVRKLYTESLIGRGDITLE
EAEQALQDFQGQLEKVFTEVRDATSQPTPTAVPEPQPEFPVAVSTAVSQEIVKRIAESQV
NIPDRITVHPRLYPQLQRRAAMIEDDTIDWGMGETLAIGSLLMEGTPVRLAGQDSRRGTF
GQRHAVLVDRETGEDYTPLLYLTDEQARYNVYDSLLSEYAAMGFEYGYSLARPDALVMWE
AQFGDFVNGAQTIVDEFISSAEQKWGQTSGVTLLLPHGYEGQGPDHSSARIERFLQLCGQ
NNMTVAAPTLPSNYFHLLRWQVHNPHHKPLVVFTPKSMLRLKAAASKTEEFLNGSFRPVI
GDETVDPAAVRKVVFTSGKVYYDLAAERDKRGLTDTAIIRLERLYPLPGAELQAEIAKYS
GVQKFVWAQEEPANQGAWPFVALNLIDHLELSVGADLPASERLVRVSRPHSSSPAVGSNK
RHQAEQQALVNEVLEI
NT seq 3831 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccacagtcccccaacagttcgagcgtctcgaccgaccagcaggacggtcagggg
agtaaccctgccgccgcgttcggtcccaacgagtggctcgtcgacgagatctaccagcag
tacctccaggacccgaactcggtcgaccgagcctggtgggacttcttcgccgactacaag
ccgggccaggacaccagctccgcggtggccgagtccgcgccggccccggccgctgggggg
gcggcgggtaccggcgccgccgcgccggccccggtgagcaacggtgccgcgccggctccg
gtgaagcccgccgccccggccgtgccgcccgccgcccagcaggccgccccggccccggct
ccggtgaagcccgcggctccggccccggccgccgcgccggccaaggccgcgcccgccgcc
aagactgcgccggccaaggccgccgagccggccgccccgggcgccggtccggagtacgtc
acactgcgtggcccctcggccgccgtggcgaagaacatgaacgccagcctccagctgccg
acggccacctccgtgcgcgccgtcccggtcaagctgctgttcgacaaccgcatcgtcatc
aacaaccacctcaagcgcgcccgtggcggcaaggtgtccttcacgcacctgatcggctac
gccatggtgcaggcgctgaaggcgatgccctcgatgaaccactcgttcaccgagaaggac
ggcaagccgaccctggtcaagcccgagcacatcaacctcggcctcgccatcgacctggtc
aagcccaacggcgaccgccagctcgtcgtcgcggcgatcaagaaggccgagacgctgaac
ttcttcgagttctggcaggcctacgaggacatcgtccgccgcgcccgcgcgaacaagctg
acgatggaggacttcaccggcgtcaccgcctccctcaccaacccgggcggcatcggcacc
gtgcactccgtgccgcggctgatgcccggacagggcctgatcatcggcgtcggcgccatg
gagtacccggccgagttccagggcacgtcgcaggacaccctgaacaagctgggcatcgcc
aaggtcatgacgctgaccagcacctatgaccaccgggtgatccagggcgccgcctccggc
gagttcctgcggatcatgagccagctgctgctcggcgagaacgacttctacgacgagatc
ttcaaggcgctgcggatcccgtacgagccggtccgctggctgcgcgacatcgacgtctcg
cacgacgacgacgtcaccaaggccgcgcgcgtcttcgacctgatccactcctaccgggtc
cgcggccacgtcatggccgacaccgacccgctggagtaccgccagcgcaagcaccccgac
ctggacatcatcgagcacgggctcaccctgtgggacctggagcgcgagttcgccgtcggc
ggcttcgccggcaagacgatgatgaacctgcgcgacatcctgggcgtgctgcgcgactcg
tactgccgcaccaccggcatcgagttcatgcacatccaggacccgaagcagcgcaagtgg
atccaggaccgcgtggagcgcccgcacgccaagccggagcgcgacgagcagctgcggatc
ctgcgccggctcaacgcggccgaggcgttcgagaccttcctgcagacgaagtacgtcggc
cagaagcgcttctcgctggagggcggcgagtccgtcatcccgctgctcgacgcggtgctg
gacgccgccgccgagtcgcgcctggacgaggtcgtcatcggtatggcccaccgcggccgg
ctcaacgtcctcgccaacatcgtcggcaagtcgtacgcgcagatcttccgcgagttcgag
ggcaacctcgacccgaagtcgatgcacggctccggcgatgtgaagtaccacctgggcgcc
gagggcaccttcaccggcctggacggcgagcagatcgccgtctcgctgaccgccaacccc
tcccacctggaggcggtggacccggtcctggagggcgtggtccgcgccaagcaggacatc
atcggcaaggccggcaccgacttcaccgtcctgcccgtcgccctgcacggcgacgccgcc
ttcgcgggccagggcgtcgtggccgagacgctgaacatgtcgcagctgcgcggctaccgc
accggcggcaccgtgcacatcgtcatcaacaaccaggtcggcttcaccgccgccccggcc
gcgtcccgctcctcgatgtacgccacggacgtcgcgcgcatgatcgaagcgccgatcttc
cacgtcaacggcgacgacccggaggccgtggtgcgcgtcgcgcgcctcgccttcgagttc
cgccaggcgttcaacaaggacgtggtcatcgacctcatctgctaccgccgccgcggtcac
aacgagaccgacaaccccggcttcacccagccgctgatgtacgacctgatcgacaagaag
cgctcggtgcgcaagctctacaccgagtcgctgatcggtcgcggcgacatcaccctggaa
gaggccgagcaggcgctgcaggacttccagggccagctggagaaggtcttcaccgaggtc
cgcgacgccacctcccagccgaccccgaccgcggtccccgagccgcagccggagttcccg
gtggcggtctccacggccgtcagccaggagatcgtcaagcggatcgccgagtcccaggtc
aacatccccgaccggatcaccgtccacccgcggctgtacccgcagctccagcggcgcgcg
gcgatgatcgaggacgacacgatcgactggggcatgggcgagaccctggccatcggctcg
ctgctgatggagggcacccccgtccgcctggccggccaggactcccgccgcggcaccttc
ggccagcgccacgcggtgctggtggaccgggagaccggcgaggactacaccccgctgctc
tacctcaccgacgagcaggcccgctacaacgtctacgactcgctgctcagcgagtacgcg
gcgatgggcttcgagtacggctactcgctggcccggccggacgcgctggtcatgtgggag
gcccagttcggtgacttcgtcaacggcgcgcagacgatcgtcgacgagttcatcagctcg
gccgagcagaagtggggccagacctccggcgtcacactgctgctcccgcacggctacgag
ggccagggcccggaccactcctcggcccgtatcgagcgcttcctccagctgtgcgggcag
aacaacatgacggtcgccgcgccgacgctgccgtcgaactacttccacctgctgcgctgg
caggtgcacaacccgcaccacaagccgctggtcgtcttcaccccgaagtcgatgctgcgt
ctgaaggcggcggcctccaagaccgaggagttcctgaacggctccttccgcccggtcatc
ggcgacgagacggtcgacccggccgcggtccgcaaggtcgtcttcacctcgggcaaggtc
tactacgacctggccgccgagcgggacaagcgcgggctgacggacacggccatcatccgg
ctggagcggctgtacccgctgccgggcgccgagctgcaggccgagatcgccaagtactcc
ggcgtccagaagttcgtctgggcgcaggaggaaccggcgaaccagggcgcgtggccgttc
gtcgcgctcaacctgatcgaccacctggagctctcggtgggcgcggacctgccggcctcc
gagcggctcgtccgggtgtcccggccgcactcctcctccccggcggtggggtcgaacaag
cggcaccaggcggagcagcaggcgctggtcaacgaggtcttggagatctga

DBGET integrated database retrieval system