KEGG   Streptomyces bingchenggensis: SBI_04710Help
Entry
SBI_04710         CDS       T01678                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00020  Citrate cycle (TCA cycle)
sbh00190  Oxidative phosphorylation
sbh00650  Butanoate metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Module
sbh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBI_04710 (sdhA)
   00650 Butanoate metabolism
    SBI_04710 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SBI_04710 (sdhA)
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SBI_04710 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SBI_04710 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C HI0933_like DAO Thi4 Pyr_redox_2 GIDA
Motif
Other DBs
NCBI-ProteinID: ADI07830
UniProt: D7BZ94
LinkDB All DBs
Position
5860485..5862239
Genome map
AA seq 584 aa AA seqDB search
MKIHKYDTVIIGAGGAGMRAAIESTKRSRTAVLTKLYPTRSHTGAAQGGMAAALANVEED
NWEWHTFDTIKGGDYLVDQDAAEILAKEAIDSVLDLEKMGLPFNRTPNGTIDQRRFGGHS
RNHGEAPVRRSCYASDRTGHMILQTLYQNCVKEGVEFFNEFYVLDLLLTEVDGVQRTAGV
VAYELATGELHVFQAKAVVFASGGCGKFFKVTSNAHTLTGDGQAVAYRRGLPLEDMEFFQ
FHPTGIWRMGILLTEGARGEGGILRNKDGERFMEKYAPVMKDLASRDVVSRSIYTEIREG
RGCGPEGDHVYLDLTHLPPEQLDAKLPDITEFARTYLGIEPYTDPIPIQPTAHYTMGGIP
TNVLGEVLSDNDTVVPGLYAAGEVACVSVHGANRLGTNSLLDINVFGRRAGIAAAEYAAE
NDFVELPDDPATFVQGQVEGLRNATGSERVAEVRKALQETMDKNVMVFRTEQTLKEAVEE
IGHLRERFKNISVQDKGRRFNTDLLEAIELGNLLDLAEVMAVSALARKESRGGHYREDYP
NRDDVNFMRHTMAYREVGANGSESIRLDYKPVVQTRYQPMERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccacaagtacgacaccgtcatcatcggcgccggcggcgccgggatgcgcgcg
gccatcgagtcgacgaagcgcagccgcaccgcggtgctcaccaagctctacccgacccgc
tcccacaccggcgccgcccagggcggcatggccgccgccctcgcgaacgtcgaggaggac
aactgggagtggcacaccttcgacacgatcaagggcggcgactacctggtcgaccaggac
gccgccgagatcctggcgaaggaggccatcgactcggtcctcgacctggagaagatgggc
ctgccgttcaaccggaccccgaacggcaccatcgaccagcgccgcttcggcggccacagc
cgtaaccacggcgaggccccggtccgccggtcctgctacgcctcggaccgcaccggccac
atgatcctccagacgctgtaccagaactgcgtcaaggagggcgtggagttcttcaacgag
ttctacgtcctggatctgctgctgaccgaggtcgacggcgtccagcgcaccgcgggtgtg
gtggcgtacgagctggcgaccggcgagctccatgtcttccaggcgaaggccgtcgtcttc
gcctcgggcggctgcggcaagttcttcaaggtgacctccaacgcccacaccctgaccggt
gacggccaggcggtcgcctaccggcgcgggctgccgctggaggacatggagttcttccag
ttccacccgaccggcatctggcgcatgggcattctgctcaccgagggcgcccgtggtgag
ggcggcatcctgcgcaacaaggacggcgagcgcttcatggagaagtacgcgccggtcatg
aaggacctcgcctcccgcgacgtggtctcgcgctccatctacaccgagatccgggagggc
cgcggctgcggtcccgagggcgaccacgtctacctggacctgacccacctgccgccggag
cagctggacgccaagctgcccgacatcaccgagttcgcccggacgtacctgggtatcgag
ccctacacggacccgatcccgatccagccgaccgcgcactacacgatgggcggcatcccg
accaacgtcctgggtgaggtgctgtccgacaacgacaccgtcgtgccgggcctgtacgcg
gcgggcgaggtggcctgtgtctccgtgcacggcgccaaccgcctgggcaccaactcgctc
ctcgacatcaacgtcttcggccgccgggccggcatcgccgccgcggagtacgccgccgag
aacgacttcgtcgagctccccgacgacccggccacgtttgtccagggccaggtcgagggg
ttgcggaacgccaccggcagcgagcgggtcgccgaggtccgcaaggcgctgcaggagacc
atggacaagaacgtcatggtcttccgcaccgagcagacgctgaaggaggccgtcgaggag
atcggccacctgcgcgagcgcttcaagaacatcagcgtccaggacaagggcaggcggttc
aacaccgaccttctcgaggcgatcgagctgggcaacctgctcgacctggccgaggtcatg
gccgtctccgcgctggcccgcaaggagtcgcgcggcggccactaccgcgaggactacccg
aaccgcgacgacgtcaacttcatgcgccacaccatggcgtaccgcgaggtgggcgccaac
ggttccgagtccatccgcctcgactacaagccggtcgtgcagacccgctaccagccgatg
gagcgtaagtactga

DBGET integrated database retrieval system