KEGG   Streptomyces bingchenggensis: SBI_04711Help
Entry
SBI_04711         CDS       T01678                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00020  Citrate cycle (TCA cycle)
sbh00190  Oxidative phosphorylation
sbh00650  Butanoate metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Module
sbh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBI_04711 (sdhB)
   00650 Butanoate metabolism
    SBI_04711 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SBI_04711 (sdhB)
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SBI_04711 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SBI_04711 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_16 Fer4_18 Fer4_4 Fer4_6 Fer4_2 Fer4_21 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ADI07831
UniProt: D7BZ95
LinkDB All DBs
Position
5862239..5863012
Genome map
AA seq 257 aa AA seqDB search
MSTPTLDKPAEAPEAAAATASHLVTVTFRIRRFNPEVAADAFWEDFQIDIDPKERVLDGL
HKIKWDLDGTLTFRRSCAHGICGSDAMRINGRNRLACKTLIKDINPEKPITIEAIKGLTV
LKDLVVDMDPFFQAYRDVMPFLITTGNEPTRERLQSAEDRERFDDTTKCILCAACTSSCP
VFWNDGQYFGPAAIVNAHRFIFDSRDEGGEQRLEILNDKDGVWRCRTTFNCTEACPRGIE
VTKAIQEVKRALITRRF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgacgcttgacaagcccgccgaggctccggaggcggccgcggcgaccgct
tcgcacctggtcacggtcaccttccggatccgccggttcaacccggaggtcgcggccgat
gcgttctgggaggacttccagatcgacatcgaccccaaggagcgcgtcctcgacgggctt
cacaagatcaagtgggatctggacggcaccctgaccttccgccgctcctgcgcccatggc
atctgcggctccgacgccatgcggatcaacggccgcaaccggctcgcctgcaagacgctg
atcaaggacatcaaccctgagaagcccatcacgatcgaggccatcaagggcctcacggtc
ctcaaggacctggtcgtggacatggatccgttcttccaggcgtaccgcgatgtgatgccc
ttcctgatcaccacgggcaacgagccgacgcgcgagcgcctgcagtccgccgaggaccgc
gagcgcttcgacgacaccaccaagtgcatcctgtgcgccgcgtgcacctcctcgtgcccg
gtgttctggaacgacggccagtacttcggcccggcggcgatcgtcaacgcgcaccgcttc
atcttcgactcgcgcgacgagggcggtgagcagcgcctggagatcctgaacgacaaggac
ggcgtctggcgctgccgcaccaccttcaactgcacggaggcctgcccgcgtggcatcgag
gtcaccaaggccatccaggaggtgaagcgcgcgctgatcacgcggcgcttctga

DBGET integrated database retrieval system