KEGG   Streptomyces bingchenggensis: SBI_05901Help
Entry
SBI_05901         CDS       T01678                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00010  Glycolysis / Gluconeogenesis
sbh00053  Ascorbate and aldarate metabolism
sbh00071  Fatty acid degradation
sbh00280  Valine, leucine and isoleucine degradation
sbh00310  Lysine degradation
sbh00330  Arginine and proline metabolism
sbh00340  Histidine metabolism
sbh00380  Tryptophan metabolism
sbh00410  beta-Alanine metabolism
sbh00561  Glycerolipid metabolism
sbh00620  Pyruvate metabolism
sbh00625  Chloroalkane and chloroalkene degradation
sbh00903  Limonene and pinene degradation
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_05901
   00053 Ascorbate and aldarate metabolism
    SBI_05901
   00620 Pyruvate metabolism
    SBI_05901
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SBI_05901
   00561 Glycerolipid metabolism
    SBI_05901
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SBI_05901
   00310 Lysine degradation
    SBI_05901
   00330 Arginine and proline metabolism
    SBI_05901
   00340 Histidine metabolism
    SBI_05901
   00380 Tryptophan metabolism
    SBI_05901
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SBI_05901
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SBI_05901
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SBI_05901
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SBI_05901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADI09021
UniProt: D7CGB7
LinkDB All DBs
Position
7177518..7178975
Genome map
AA seq 485 aa AA seqDB search
MSYFSELAFQYIDGEWRTGSGSWDIVDFNPYNGEKLASITVATVQEIDLAYRAAERAQPE
WGGTNPYTRRLVFERALRIIEDREKELTEAIIAECGGTHVKAGFELHLAKEFLREAIQLA
LRPEGRILPSPVDGKENRLYRLPVGVVGVISPFNFPFLLSIKSVAPALALGNSVVLKPHQ
NTPICGGGLVAKVFEDAGLPAGLLNVVVTDIAEIGDALIEHPVPKVISFTGSDKVGRHVA
TVAASHFKRSILELGGNSALVVLDDADVDYAVNAAVFSRFVHQGQVCMAANRVLVDRRIE
REFTEKFVAKVESLKVGDPSDLTTHIGPLINEGQAEAISSLVEQAVAEGATALVRGRTEG
TLVAPSVLTGVAEDAAILSQEIFGPVVLLIPFDGDEDAIRLANATEYGLSGAVHTGDIER
GVSFAKRVRTGMIHVNDSTVHDEPIVPFGGEGNSGLGRLNGDSFVEDFTTTKWISVQYGR
SQFPF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacttctccgagctggcctttcagtacatcgacggtgagtggcggaccggcagc
ggttcctgggacatcgtcgatttcaacccctataacggggagaagctcgcctccatcacc
gtggccaccgtccaggagatcgacctggcctaccgcgccgccgagcgggcacagccggag
tggggcggcaccaatccgtacacccggcgcctggtcttcgagcgggccctgcggatcatc
gaggaccgtgagaaggagctcacggaggcgatcatcgcggagtgcggtggcacgcatgtg
aaggcggggttcgaactgcacctcgccaaggagtttcttcgcgaggcgatccagttggcg
ctgcggcccgaggggcgcatcctgccctcgccggtcgacggcaaggagaaccgcctctac
cggcttccggtcggagtggtcggggtcatcagcccgttcaacttccccttcctgctgtcg
atcaagtcggtcgccccggcgctcgcgctgggcaactccgtcgtgctcaagccgcatcag
aacactccgatctgcggtggcgggctggtcgccaaggtcttcgaggacgccggactgccc
gccgggctgctgaatgtggtggtcaccgacatcgccgagatcggcgacgccctgatcgag
cacccggtgccgaaggtcatctccttcaccggctcggacaaggtcggccgccatgtcgcc
accgtcgcggcctcccacttcaagcgctccatcctggaactgggcggcaacagcgccctg
gtcgtcctcgacgacgccgatgtggactacgcggtgaacgccgccgtcttcagccgcttc
gtccaccagggccaggtctgtatggccgcgaaccgggtgctcgtggaccgccggatcgag
cgcgagttcaccgagaagttcgtcgccaaggtcgagtcgctgaaggtcggcgacccgagc
gatctgacgacacatatcggcccgctgatcaacgagggccaggccgaggccatcagctcc
ctggtcgagcaggccgtcgccgagggcgccaccgcgctggtgcgcgggcggaccgagggc
acgctcgtcgcccccagtgtgctcaccggggtcgcggaggacgccgcgatcctcagccag
gagattttcggccccgtggtcctgctgatccccttcgacggggacgaggacgccatccgg
ctcgccaacgccacggagtacgggctgagcggcgccgtgcacaccggcgatatcgagcgc
ggggtgagcttcgccaagcgcgtgcgcaccggcatgatccacgtcaacgacagcacggtc
cacgacgagccgatcgtgcccttcggcggggaggggaactccgggctcggacggctcaac
ggcgactcctttgtcgaggacttcaccaccaccaagtggatctccgttcagtacggccgc
agccagttcccgttctga

DBGET integrated database retrieval system