KEGG   Streptomyces bingchenggensis: SBI_06244Help
Entry
SBI_06244         CDS       T01678                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00473  D-Alanine metabolism
sbh01100  Metabolic pathways
sbh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SBI_06244
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SBI_06244
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbh01011]
    SBI_06244
Enzymes [BR:sbh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SBI_06244
Peptidoglycan biosynthesis and degradation proteins [BR:sbh01011]
 Precursor biosynthesis
  Racemase
   SBI_06244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Dimeth_Pyl DUF3775
Motif
Other DBs
NCBI-ProteinID: ADI09364
UniProt: D7BS46
LinkDB All DBs
Position
7546876..7548030
Genome map
AA seq 384 aa AA seqDB search
MNETPMRARAVVDLAALRANVRALRAAAPGAELMAVVKSDAYGHGAVPCARAAREAGASW
LGTATPEEALALRAAGDTGRLLCWLWTPGGPWREAIEADVDVSLSAMWALREAVAAAREC
GRTARVQLKADTGLGRNGCPPADWPELVAAARAAEAEGTVTVTGLWSHFACADEPGHPSI
AAQLKVFRTLLAQAEQAGLRPEVRHIANSPATLTLPESHFDLVRTGIAVYGISPSPEVGH
PGDFGLRPVMTLVASLASVKRVPGGHGVSYGHRYITPGPTTLALVPVGYADGVPRHASGT
GPVLVAGKWRTVAGTVAMDQFVVDLGGDAAAPGDEAVLFGPGDRGEPTAEDWARAVGSIA
YEIVTRISARVPRVYVGRAEGTGN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacaccgatgcgtgcccgtgccgtggtcgacctggccgccctgcgggccaat
gtgcgggcgctgcgcgcggcggcgcccggggccgagctgatggccgtggtcaagtcggac
gcctacggccacggcgcggtgccgtgcgcgcgcgccgcgcgtgaggcgggcgcgagctgg
ctgggcacggccacgcccgaggaggcgctggcgctgcgcgccgcgggcgacacgggccgg
ttgctgtgctggctgtggacgccgggcggcccgtggcgggaggcgatcgaggctgatgtc
gacgtgtcgctgagcgcgatgtgggcgctgcgggaggccgtggccgcggcccgggagtgc
ggccgtaccgcgcgcgtccagctgaaggcggacacggggctcggccgcaacggctgcccg
cccgcggactggccggaactcgtcgccgccgcgcgcgccgccgaggctgagggcacggtc
acggtgaccggtctgtggtcgcacttcgcctgcgcggacgagccggggcacccctcgatc
gccgcgcaactgaaggtgttccggacgctgctggcgcaggccgagcaggcggggctgcgc
ccggaggtgcggcatatcgccaactcgccggcgacgctgaccctgcccgagtcgcatttc
gacctggtacggaccgggatcgcggtgtacgggatctcgccgagccccgaggtcggccat
ccgggcgacttcgggctgcggccggtgatgacactggtcgcctcgctggcctcggtgaag
cgggtgccgggcggacacggcgtgtcgtacgggcaccgctacatcacccctggcccgacc
acgctcgcgctggtgccggtgggctacgcggacggggttccgcggcacgcctcggggacc
ggtccggtcctggtcgcgggtaagtggcggacggtcgcgggcacggtggcgatggaccag
ttcgtggtggacctcggcggggacgccgcggcgcccggggacgaggcggtgctgttcggg
cccggtgaccggggcgagccgaccgcggaggactgggcgcgggcggtcggctcgatcgcg
tacgagatcgtcacgcggatctcggcgcgtgtgccgcgcgtttatgtcggtcgggctgag
ggcacagggaactga

DBGET integrated database retrieval system