KEGG   Streptomyces bingchenggensis: SBI_06353Help
Entry
SBI_06353         CDS       T01678                                 

Definition
(GenBank) protein kinase family protein
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
sbh  Streptomyces bingchenggensis
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbh01001]
    SBI_06353
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SBI_06353
Protein kinases [BR:sbh01001]
 Serine/threonine kinases: Other
  Bacterial family
   SBI_06353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR Pkinase PknG_rubred Pkinase_Tyr TPR_19 RIO1
Motif
Other DBs
NCBI-ProteinID: ADI09473
UniProt: D7BSF5
LinkDB All DBs
Position
complement(7672391..7674748)
Genome map
AA seq 785 aa AA seqDB search
MTDGTSGGAAVCDRPDCPGAGRGRINVRGFCSECGRKARGRAVGSPSPDTPAPAPASAPA
SASASASAILESESTATAARARRRAVARKFTVRPAGDGLMDLPRVELPSLRDLVIDDPQP
PPQGQPCAGCEVTVGAAYAGQPALWTGVCHRCRHPFDFTPQLRPGDLLGGQYEVIGGVAY
GGLGWVYLAEDTQLDRQPVAIKGLINDDDETAQRAAIEERRYLTMLDHPGIVSIINYVRH
PARGSGRPQGYIVMEFVAGVTLSTIGDYIARVDPHFDGPRVYQHILTYGALALDALEYLH
GEKLVYCDLKPSNVMHHEGRVKVIDLGAVRQLGQRDGRPVITEKFAAPEVVHHGALPTEL
HDLYGVGKTLKNLSDKVRRAAQRPPGLGRESYDRLLARATAYDPRQRFGSAREMAEQLRG
VLREIHSLRLEREQPEPSTLFAPTAALLDSGLGRIPGLERWLTGQARPVLADGRPGPKRV
PLGLPVPFPDAKDPGAALLNTPTDSGPRRLIEQLRAFPHESAEIRFRICRAHLELDEVDE
AKAQVKAVERIIGGDRAPYEWRLNWHRALVRLAEGAVAEARREFDAVYGALPGEYAPKLA
LGYCAEHLADHDAAERFYQAVWQRNRSQGSAAFGLARLRLAAGDRTGAVDVLSEVPKVSR
HHDAAQIATVRVLAGRLGHPDGLPTEADFAEVLTRLPRLYLDDGRSSGHARERLTAEVWE
VALDWVLRYGNKEEAGALFGKRDEEAVVRADLERALRDLAQQADRPEAVEVLVDRANAVR
PMTRV
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgggacgagcggcggggcggcggtctgcgaccggcccgactgccccggtgcc
ggccgcggccggatcaacgtccggggcttctgctcggagtgcggccgcaaggcccggggc
cgggccgtcggcagcccctcccccgacacacccgcgcccgcgcccgcctccgcgcccgcc
tccgcgtccgcgtccgcctccgccatcctggagtccgagtccaccgccaccgcggcccgc
gcacgacggcgcgccgtggcccggaagttcaccgtccgccccgccggcgacggcctgatg
gacctgccgcgcgtcgaactcccctccctccgcgacctggtcatcgacgatccccagccg
cccccgcagggacagccctgcgcgggctgcgaggtgaccgtgggcgcggcatacgccggg
cagcccgcgctgtggaccggggtctgccaccgctgccgccaccccttcgacttcaccccg
cagctgcggcccggggatctgctgggcggccagtacgaggtgatcggcggggtggcgtac
gggggtctgggctgggtctatctcgccgaggacacccagctggaccgccagcccgtcgcc
atcaaggggctgatcaacgacgatgacgagacggcgcagcgcgcggccatcgaggagcgc
cgctatctgaccatgctcgaccacccgggcattgtcagcatcatcaactacgtccgccac
ccggcccgcggcagcggccggccgcagggctacatcgtgatggagttcgtcgccggggtg
accctctcgacgatcggggactacatcgcccgcgtcgacccgcacttcgacggaccgcgc
gtctaccagcacatcctcacctacggcgcgctggccctcgacgcgctggagtatctgcac
ggcgagaagctggtctactgcgacctcaagccgagcaatgtcatgcaccacgagggccgg
gtcaaggtgatcgacctcggcgcggtccgccagctggggcagcgggacggccgtcccgtc
atcaccgagaagttcgccgcccccgaggtggtccaccacggcgccctccccaccgagctc
catgacctctacggcgtcgggaagaccctgaagaacctctccgacaaggtcaggcgggcc
gcccagcggccgccgggcctcggccgcgagtcgtacgacaggctcctggcccgcgccacg
gcctatgacccgcggcagcggttcggctccgcccgcgagatggccgagcagctgcgcggg
gtgctccgcgagatccattccctgcggctggagcgggagcagcccgagccctccacgctg
ttcgccccgaccgcggccctgctcgactccgggctcggccggatccccggtctggagcgc
tggctgaccggtcaggcccgtccggtgctcgcggacgggcggcccggcccgaagagagtg
ccgctcgggctgccggtgccgttccccgacgccaaggacccgggcgcggcgctgctcaac
accccgaccgacagcggcccgcggcggctgatcgagcagttgcgggcctttccgcacgag
tccgccgagatacggttccgcatctgccgcgcccatctcgaactcgacgaggtggacgag
gcaaaggcccaggtgaaggccgtcgagcggatcatcggcggggaccgggcgccgtacgaa
tggcggctgaactggcaccgcgcgctggtgcggctcgccgagggcgcggtggccgaggcc
cggcgggagttcgacgcggtgtacggggcgctgcccggggagtacgcgcccaagctcgcc
ctcgggtactgcgccgagcacctggccgaccacgacgccgcggaacggttctaccaggcg
gtctggcagcgcaaccgctcccagggcagcgccgctttcggcctggcccggctgcggctg
gccgcgggcgaccgcaccggggcggtcgacgtcctcagcgaggtgccgaaggtctcgcgc
caccacgacgccgcccagatcgccacggtgcgggtgctggccggccggctgggccacccg
gacgggctgccgaccgaggcggacttcgcggaggtgctgacccggctgccgcggctgtat
ctggacgacggacggtcctcgggccacgcccgcgagcggctgaccgccgaggtgtgggag
gtcgccctcgactgggtgctccggtacgggaacaaggaggaggccggggcgctgttcgga
aagcgcgacgaggaggccgtggtgcgcgccgatctcgaaagggccctgcgggacctggcc
cagcaggcggaccgccccgaggccgtggaggtgctggtcgaccgggccaacgccgtcagg
cccatgacccgcgtctga

DBGET integrated database retrieval system