KEGG   Streptomyces bingchenggensis: SBI_06524Help
Entry
SBI_06524         CDS       T01678                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
sbh  Streptomyces bingchenggensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ADI09644
UniProt: D7BVR5
LinkDB All DBs
Position
7878422..7880188
Genome map
AA seq 588 aa AA seqDB search
MDHDQGAHDVRPVGSKYLLEEPLGRGATGTVWRARQREAAGSEAAVAGQPGETVAIKVLK
EELANDAEIVMRFLRERSVLLRLTHPNIVRTRDLVVEGDLLALVMDLIDGPDLHNYLRRN
GPFTPMAAALLMAQIADALAASHADGVVHRDLKPANVLLAGTGEGEEMHPMLTDFGIARL
ADSPGLTRTHEFVGTPAYVAPESAEGRPQTSAVDIYGAGIMLYELVTGRPPFAGNTALEV
LHRHLSEEPRRPTTVPEPLWTVIERCLRKSPEDRPSAENLARGLRVVAAGVGVHATPAQA
EAALGVGALLAPDPAPAPVPDADPTGAADPTQVLPSNASGASSFDPAAATSVLPQTGGPG
GGANADPTQVLPAGSGPASGADPTRAMPPVPPGQGPDDPHPWQNQLRAARDRNEQTQVQY
LDPSQDPLRRRPQRRPAPQQPPQHQQPQQYQAQQPQQYQPQQPQQPPRRQQRRQQPPPYA
QQQPQNYAPAPHHPQQPQPQRYAPPPQQPQQPEPRQPRQRSSSPMKIPGMGCLKGCLFVI
VILIVGSWLIWELTPLKDWVAEGKSYWDAVTDWITEVKDWISKLGGPS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggaccacgaccagggagcgcatgacgtgcggccggtaggcagcaagtacctgctcgag
gagccgctcggacgcggagccacgggcaccgtctggcgagcccgccagcgggaggcggcg
ggctccgaggccgctgtggccgggcagcccggcgagaccgtcgcgatcaaggtcctcaag
gaggagctggcaaacgacgcggagatcgtgatgcgcttcctgcgcgagcgctccgtgctg
ctgcggctcacccaccccaacatcgtccgcacccgcgacctggtcgtcgagggcgatctg
ctcgccctggtcatggacctgatcgacggcccggacctgcacaactacctgcgtcgtaac
ggcccgttcacacccatggccgccgccctgctgatggcccagatcgccgacgcgctcgcc
gccagccacgccgacggcgtcgtgcaccgcgacctcaaacccgccaacgtgctgctggcc
ggcacgggcgagggcgaggagatgcacccgatgctgaccgacttcggcatcgcgcgcctc
gcggactcgccgggcctcacccgcacccatgagttcgtcggcacgcccgcctatgtggcg
ccggagtcggccgagggccgcccgcagacctccgcggtggacatctacggcgccgggatc
atgctgtacgagctggtcaccggccgtccgccgttcgcgggcaacacggcgctcgaggtg
ctgcaccggcatctgagcgaggagccgcgccgccccaccaccgtgcccgagcccctgtgg
acagtcatagagcgctgtctgcgcaagagcccggaggaccggcccagcgccgagaacctg
gcccgcgggctgcgcgtggtcgccgcgggcgtcggggtgcacgccacgcccgcgcaggcc
gaggccgcgctcggcgtcggcgcgctgctcgccccggacccggcgcccgccccggtgcct
gacgccgaccccacgggcgccgccgacccgacccaggtgctcccgtccaacgcctcgggc
gcttcctcgttcgaccccgccgcggccaccagcgtgctgcctcagaccggcggccccggc
ggcggcgcgaacgccgaccccacccaggtgctgcccgccggctccggtccggcctccggc
gccgacccgacccgcgcgatgccgcccgtgccgcccggccagggtccggacgatccgcac
ccctggcagaaccagctgcgcgcggcccgagaccgcaacgagcagacgcaggtccagtac
ctcgacccgagccaggacccgctgcgccgccgcccccagcgccgccccgccccgcagcag
ccgccgcagcaccagcagcctcagcagtaccaggcgcagcaaccccagcagtatcagccg
cagcagccccagcagccgccgcggaggcagcagcggcgccagcagccgcccccgtacgcc
cagcagcagccccagaactacgccccggcgccgcaccacccccagcagccacagccccag
cgctacgcgccgccgccccagcagccgcagcagcccgagccgcgccagccccggcagcgc
agctccagcccgatgaagatccccggtatggggtgcctcaagggctgtctgttcgtgatc
gtgatcctgatcgtgggttcctggctgatctgggagctgaccccgctcaaggactgggtc
gccgagggcaagagctactgggacgcggtcaccgactggatcaccgaggtgaaggactgg
atctccaagctcggcgggcccagctga

DBGET integrated database retrieval system