KEGG   Streptomyces bingchenggensis: SBI_07038Help
Entry
SBI_07038         CDS       T01678                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00020  Citrate cycle (TCA cycle)
sbh00190  Oxidative phosphorylation
sbh00650  Butanoate metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Module
sbh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBI_07038 (sdhB)
   00650 Butanoate metabolism
    SBI_07038 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SBI_07038 (sdhB)
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SBI_07038 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SBI_07038 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_17 Fer4_9 Fer4_10 Fer4 Fer4_4 Fer4_21 Fer4_18 Fer4_6 Fer4_15 Fer4_2 Fer4_16 Fer4_13 Fer4_3 Fer2 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ADI10158
UniProt: D7C3D3
LinkDB All DBs
Position
complement(8419126..8419875)
Genome map
AA seq 249 aa AA seqDB search
MRLTLRIWRQHGPNEPGAMTAYEVDGISPEMSFLEMLDTLNEELILRGEEPVAFDHDCRE
GICGACGMVINGQAHGPERTTTCQLHMRHFSDGDTIDVEPWRAAAFPVVKDLVVDRSAFD
RIIGSGGYISAPTGSAPDAHATPVPKPVADTAFEHAECIGCGACVAACPNGSAMLFTSAK
VVHLNVLPQGQPERESRVLDMVGAMDEEGFGGCTNTGECAVACPKGIPLQSISMMNREFL
RASMKGGRS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcaccctgcggatctggcgccagcacggcccgaacgagccgggcgccatgacc
gcgtacgaagtcgacggcatctcgcccgagatgtccttcctggagatgctggacaccctc
aacgaggagctgatcctgcgcggcgaggagcccgtggccttcgaccacgactgccgcgag
ggcatctgcggggcgtgcggcatggtcatcaacggccaggcgcacggccccgagcgcacc
actacctgccagctgcatatgcggcacttctccgacggtgacacgatcgacgtcgagccg
tggcgtgccgccgccttccccgtggtcaaggacctggtcgtggaccgctcggccttcgac
cggatcatcggctccggcggctatatctccgcgccgaccggcagcgccccggacgcgcac
gccacgcccgtgcccaagccggtcgccgacacggccttcgagcacgccgagtgcatcggc
tgcggagcctgcgtggcggcctgccccaacggctcggcgatgctcttcacctcggccaag
gtcgtccatctgaacgtgctgccgcaggggcagcccgagcgcgagtcgcgggtgctggac
atggtgggcgcgatggacgaggagggcttcggcggctgcaccaacaccggggagtgcgcg
gtggcctgccccaaggggatcccgctgcagagcatttccatgatgaaccgggaattcctg
cgggcgagcatgaagggcggccgcagctga

DBGET integrated database retrieval system